Comparing GFF209 FitnessBrowser__WCS417:GFF209 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
25% identity, 89% coverage: 6:196/214 of query aligns to 15:201/214 of 4ymwC
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
25% identity, 89% coverage: 6:196/214 of query aligns to 15:201/215 of 4ymtC
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
32% identity, 52% coverage: 59:170/214 of query aligns to 60:165/506 of A0A0H2ZQB9
Sites not aligning to the query:
>GFF209 FitnessBrowser__WCS417:GFF209
MWFDRLVQGAIDTLLMVGVSSLIALLVGIPLAVFLVTSDKGGIYQAPALNRVLGAFVNLF
RSIPFLILMVALIPFTRLIVGTTYGVWAAVVPLTIAATPFFARIAEVSLREVDHGLIEAA
QAMGCRRWHIIWHVLLPEALPGIVGGFTITLVTMINSSAMAGAIGAGGLGDIAYRYGYQR
FDTQIMLTVIVLLVLLVAVIQLGGDRLARGLNKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory