Comparing GFF2161 FitnessBrowser__WCS417:GFF2161 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
5abpA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
60% identity, 90% coverage: 32:332/334 of query aligns to 2:302/305 of 5abpA
1abfA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
60% identity, 90% coverage: 32:332/334 of query aligns to 2:302/305 of 1abfA
1abeA Novel stereospecificity of the l-arabinose-binding protein (see paper)
60% identity, 90% coverage: 32:332/334 of query aligns to 2:302/305 of 1abeA
4kzkA The structure of the periplasmic l-arabinose binding protein from burkholderia thailandensis
43% identity, 90% coverage: 32:332/334 of query aligns to 1:301/301 of 4kzkA
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
32% identity, 30% coverage: 33:132/334 of query aligns to 4:103/297 of 4ry9B
Sites not aligning to the query:
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
32% identity, 30% coverage: 33:132/334 of query aligns to 4:103/297 of 4ry9A
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
24% identity, 69% coverage: 33:263/334 of query aligns to 4:227/287 of 5dteB
Sites not aligning to the query:
5kwsA Crystal structure of galactose binding protein from yersinia pestis in the complex with beta d glucose
25% identity, 60% coverage: 71:269/334 of query aligns to 44:240/307 of 5kwsA
Sites not aligning to the query:
>GFF2161 FitnessBrowser__WCS417:GFF2161
MNRRRGLRSLCCAAVAVSAMSLSGLLLAAEEVKIGFLVKQAEEPWFQTEWAFAEKAGKEH
GFTVIKIAVPDGEKTLSAIDSLAANGAKGFVICPPDVSLGPAIVAKAKANGLKVIAVDDR
FVDAKGNFMEDVPYLGMAAFEVGQKQGAAMAAEAKKRGWDWKDTYAVINTFNELDTGKKR
TDGSVKSLEEAGIPKDHILFTAAKTLDVPGSMDATNSALVKLPSGAKNLIIGGMNDNTVL
GGVRATESAGFKAANVIGIGINGTDAIGELKKPSSGFFGSMLPSPHIEGYNTALMMYEWV
TKGTEPAKYTAMDEVTLITRENFQAELTKIGLWQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory