Comparing GFF2199 FitnessBrowser__Marino:GFF2199 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
3i09A Crystal structure of a periplasmic binding protein (bma2936) from burkholderia mallei at 1.80 a resolution
25% identity, 92% coverage: 22:401/415 of query aligns to 2:368/375 of 3i09A
3i45A Crystal structure of putative twin-arginine translocation pathway signal protein from rhodospirillum rubrum atcc 11170
26% identity, 80% coverage: 42:372/415 of query aligns to 21:348/378 of 3i45A
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
24% identity, 83% coverage: 23:366/415 of query aligns to 1:333/348 of 4gnrA
7s6eB Crystal structure of urta from synechococcus cc9311 in complex with urea and calcium
23% identity, 79% coverage: 16:343/415 of query aligns to 1:330/400 of 7s6eB
Sites not aligning to the query:
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
27% identity, 70% coverage: 47:338/415 of query aligns to 21:297/336 of 4mlcA
8hicA Crystal structure of urta from prochlorococcus marinus str. Mit 9313 in complex with urea and calcium
24% identity, 71% coverage: 50:343/415 of query aligns to 30:325/395 of 8hicA
Sites not aligning to the query:
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
26% identity, 70% coverage: 47:338/415 of query aligns to 21:296/335 of 4q6bA
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
23% identity, 76% coverage: 25:338/415 of query aligns to 3:306/345 of 4n0qB
1peaA Amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with acetamide (see paper)
22% identity, 69% coverage: 27:314/415 of query aligns to 3:279/368 of 1peaA
1qo0B Amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir. (see paper)
22% identity, 69% coverage: 27:314/415 of query aligns to 4:280/374 of 1qo0B
4zpjA Abc transporter substrate-binding protein from sphaerobacter thermophilus
24% identity, 84% coverage: 23:369/415 of query aligns to 1:348/371 of 4zpjA
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
25% identity, 33% coverage: 22:156/415 of query aligns to 1:142/376 of 4q6wA
Sites not aligning to the query:
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
34% identity, 20% coverage: 27:108/415 of query aligns to 5:85/348 of 3ipcA
Sites not aligning to the query:
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
34% identity, 20% coverage: 27:108/415 of query aligns to 5:85/348 of 3ip9A
Sites not aligning to the query:
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
34% identity, 20% coverage: 27:108/415 of query aligns to 5:85/348 of 3ip7A
Sites not aligning to the query:
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
34% identity, 20% coverage: 27:108/415 of query aligns to 5:85/348 of 3ip6A
Sites not aligning to the query:
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
34% identity, 20% coverage: 27:108/415 of query aligns to 5:85/348 of 3ip5A
Sites not aligning to the query:
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
23% identity, 73% coverage: 24:328/415 of query aligns to 1:294/350 of 3td9A
>GFF2199 FitnessBrowser__Marino:GFF2199
MNVRKVLFSACLLLLASTTVYAETLKIGLNYPQTGRYKDQGLQQRLGAFLAVDEINKAGG
VMGRQLELVIRNTRGDPAQGAKNTAELIDREGVQMVFGGVSSAVAIASGKAARDRNRIYF
GTLTYSNATTGAEGHSYMFREPYNAWMTAKALSQYLTTNHAEDDYFYITADYTWGWSVEE
SVRKFSGTEDTDRHQGVKTPFPGHITDFREALEQAEASNAKVLMMVLFGDDMVRALNVAY
EMGLTKKMQIVVPNLTLGMARQVGPTIMEGVIGGSPWVWNVPYELNYPRGKEFVEAFSAR
YEMRPSTAAASAYSIVYQYKDAVERTGTTNTASLIRALEGHRYTFLKDEQYWREFDHQNV
QTVYVVKVKPRNTIIADEYSSDYFSIIDSMPGDQAAQTREEWEERRREAGKPLQL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory