Comparing GFF2306 FitnessBrowser__psRCH2:GFF2306 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7svqA Crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with NAD+ (see paper)
29% identity, 87% coverage: 3:283/323 of query aligns to 12:268/315 of 7svqA
Sites not aligning to the query:
7ezlA Rice l-galactose dehydrogenase (holo form)
27% identity, 88% coverage: 8:292/323 of query aligns to 18:278/318 of 7ezlA
Sites not aligning to the query:
7eziA Rice l-galactose dehydrogenase (apo form)
27% identity, 88% coverage: 8:292/323 of query aligns to 23:283/323 of 7eziA
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
28% identity, 90% coverage: 8:299/323 of query aligns to 16:292/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
28% identity, 90% coverage: 8:299/323 of query aligns to 15:291/311 of 1pz0A
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
26% identity, 89% coverage: 3:291/323 of query aligns to 12:265/298 of 1ynqB
Sites not aligning to the query:
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
26% identity, 89% coverage: 3:291/323 of query aligns to 12:265/298 of 1ynpB
Sites not aligning to the query:
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
26% identity, 89% coverage: 3:291/323 of query aligns to 12:250/283 of 1ynpA
Sites not aligning to the query:
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
23% identity, 96% coverage: 3:311/323 of query aligns to 11:326/326 of P77256
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
27% identity, 89% coverage: 4:289/323 of query aligns to 5:268/301 of 6ow0B
Sites not aligning to the query:
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
26% identity, 89% coverage: 4:289/323 of query aligns to 5:292/323 of 6ow0A
Sites not aligning to the query:
3n6qD Crystal structure of yghz from e. Coli (see paper)
26% identity, 92% coverage: 3:299/323 of query aligns to 22:293/315 of 3n6qD
4aubE The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
25% identity, 92% coverage: 3:299/323 of query aligns to 22:281/297 of 4aubE
Sites not aligning to the query:
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
27% identity, 89% coverage: 3:289/323 of query aligns to 23:288/315 of 5t79A
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
25% identity, 92% coverage: 3:299/323 of query aligns to 21:306/335 of 4aubB
Sites not aligning to the query:
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
27% identity, 89% coverage: 3:289/323 of query aligns to 22:283/312 of 3erpA
1exbA Structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels (see paper)
22% identity, 83% coverage: 22:289/323 of query aligns to 29:294/326 of 1exbA
Sites not aligning to the query:
3eauA Voltage-dependent k+ channel beta subunit in complex with cortisone (see paper)
22% identity, 83% coverage: 22:289/323 of query aligns to 30:295/327 of 3eauA
Sites not aligning to the query:
P62483 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; EC 1.1.1.- from Rattus norvegicus (Rat) (see 11 papers)
22% identity, 83% coverage: 22:289/323 of query aligns to 64:329/367 of P62483
Sites not aligning to the query:
P62482 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; Neuroimmune protein F5; EC 1.1.1.- from Mus musculus (Mouse) (see 2 papers)
22% identity, 83% coverage: 22:289/323 of query aligns to 64:329/367 of P62482
Sites not aligning to the query:
>GFF2306 FitnessBrowser__psRCH2:GFF2306
MRITLPRIGLGGAPLGNMFHPLSEETADATLNAAWDAGFRYYDVSPHYGAGLAEQRFGRL
LSGKPRDEYVLSTKVGRLLQSAGQPENAKPFVDELPNKRVPDYSADGARRSIEDSLERMG
VDHLDVVFIHDVSEDQWGPQWKEYFQQAMNGAAKALTQLRDEGVIRGWGLGVNLVEPCRM
ALEQSDPNVFLLAGRYSLLEHDEALDTLFPTCQARDVGVVVGGPFNSGVLAGGDHYEYDQ
IPPQIAQRREQLKAAAERCGVDLRAAALHFCLANPVVASVIPGTANPERPKQYMDYFNTQ
VPREFWQTLKREGLLREDAPVPT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory