SitesBLAST
Comparing GFF2442 FitnessBrowser__Marino:GFF2442 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
30% identity, 77% coverage: 4:248/318 of query aligns to 3:257/308 of 6wj9B
- active site: A119 (≠ S116), A120 (≠ I117), A121 (≠ G118), F144 (≠ Y141), K148 (= K145)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), F12 (= F13), I13 (≠ V14), D32 (= D28), D33 (≠ V29), S35 (≠ A31), T36 (≠ V32), G37 (= G33), D55 (= D50), A56 (≠ L51), L75 (= L70), A76 (= A71), A77 (≠ G72), S94 (≠ A91), A117 (≠ V114), A119 (≠ S116), F144 (≠ Y141), K148 (= K145), F171 (≠ P169), F172 (≠ P170), I174 (≠ V172)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ G76), N173 (≠ L171), G187 (= G179), V188 (≠ N180), F192 (≠ L184), T203 (≠ P195), L204 (vs. gap), F205 (= F196), R212 (= R203), L248 (≠ T239)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
30% identity, 77% coverage: 4:248/318 of query aligns to 2:256/307 of 6wjaA
- active site: A118 (≠ S116), A119 (≠ I117), A120 (≠ G118), F143 (≠ Y141), K147 (= K145)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (≠ V14), D31 (= D28), D32 (≠ V29), S34 (≠ A31), T35 (≠ V32), G36 (= G33), A55 (≠ L51), L74 (= L70), A75 (= A71), A76 (≠ G72), S93 (≠ A91), F143 (≠ Y141), K147 (= K145), F170 (≠ P169), F171 (≠ P170), I173 (≠ V172)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ G76), A120 (≠ G118), N172 (≠ L171), G186 (= G179), V187 (≠ N180), F191 (≠ L184), T202 (≠ P195), F204 (= F196), R211 (= R203), L247 (≠ T239)
Sites not aligning to the query:
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
37% identity, 54% coverage: 4:176/318 of query aligns to 2:180/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (≠ V14), D31 (vs. gap), N32 (vs. gap), T35 (≠ V32), G36 (= G33), D56 (= D50), I57 (≠ L51), L77 (= L70), A78 (= A71), A79 (≠ G72), I81 (≠ A74), V96 (= V93), T119 (≠ V114), Y146 (= Y141), K150 (= K145), P173 (= P169), A174 (≠ P170), N175 (≠ L171), V176 (= V172)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A74), R84 (≠ K77), S121 (= S116), G123 (= G118), Y146 (= Y141), A174 (≠ P170), N175 (≠ L171)
Sites not aligning to the query:
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
37% identity, 54% coverage: 4:176/318 of query aligns to 2:180/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (≠ V14), D31 (vs. gap), N32 (vs. gap), T35 (≠ V32), G36 (= G33), D56 (= D50), I57 (≠ L51), L77 (= L70), A78 (= A71), A79 (≠ G72), I81 (≠ A74), T119 (≠ V114), Y146 (= Y141), K150 (= K145), P173 (= P169), N175 (≠ L171), V176 (= V172)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ A74), R84 (≠ K77), S121 (= S116), G123 (= G118), S124 (vs. gap), Y146 (= Y141), A174 (≠ P170), N175 (≠ L171)
Sites not aligning to the query:
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
37% identity, 54% coverage: 4:176/318 of query aligns to 2:180/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ A74), R84 (≠ K77), S121 (= S116), G123 (= G118), Y146 (= Y141), A174 (≠ P170), N175 (≠ L171)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (≠ V14), D31 (vs. gap), N32 (vs. gap), A34 (= A31), T35 (≠ V32), G36 (= G33), D56 (= D50), I57 (≠ L51), L77 (= L70), A78 (= A71), A79 (≠ G72), I81 (≠ A74), T119 (≠ V114), Y146 (= Y141), K150 (= K145), P173 (= P169), A174 (≠ P170), V176 (= V172)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A74), R84 (≠ K77), S121 (= S116), G123 (= G118), Y146 (= Y141), A174 (≠ P170), N175 (≠ L171)
Sites not aligning to the query:
- binding galactose-uridine-5'-diphosphate: 187, 188, 189, 193, 204, 206, 211, 213, 248, 271
- binding uridine-5'-diphosphate-glucose: 187, 188, 189, 193, 204, 206, 211, 213, 248, 271
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
32% identity, 56% coverage: 4:182/318 of query aligns to 2:190/338 of 2udpA
- active site: S124 (= S116), A125 (≠ I117), T126 (≠ G118), Y149 (= Y141), K153 (= K145), M189 (≠ F181)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (≠ F13), I12 (≠ V14), D31 (≠ G33), N32 (≠ R34), L33 (≠ G35), C34 (≠ G36), N35 (= N37), S36 (≠ L38), D58 (= D50), I59 (≠ L51), F80 (≠ L70), A81 (= A71), G82 (= G72), K84 (≠ A74), S122 (≠ V114), S124 (= S116), Y149 (= Y141), K153 (= K145), Y177 (≠ P169)
- binding phenyl-uridine-5'-diphosphate: N179 (≠ L171)
Sites not aligning to the query:
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
32% identity, 56% coverage: 4:182/318 of query aligns to 2:190/338 of 1udcA
- active site: S124 (= S116), A125 (≠ I117), T126 (≠ G118), Y149 (= Y141), K153 (= K145), M189 (≠ F181)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (≠ F13), I12 (≠ V14), D31 (≠ G33), N32 (≠ R34), C34 (≠ G36), N35 (= N37), S36 (≠ L38), D58 (= D50), I59 (≠ L51), F80 (≠ L70), A81 (= A71), G82 (= G72), K84 (≠ A74), S122 (≠ V114), Y149 (= Y141), K153 (= K145), Y177 (≠ P169), P180 (≠ V172)
- binding uridine-5'-diphosphate-mannose: T126 (≠ G118), Y149 (= Y141), N179 (≠ L171)
Sites not aligning to the query:
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
32% identity, 56% coverage: 4:182/318 of query aligns to 2:190/338 of P09147
- YI 11:12 (≠ FV 13:14) binding
- DNLCNS 31:36 (≠ GRGGNL 33:38) binding
- DI 58:59 (≠ DL 50:51) binding
- FAGLK 80:84 (≠ LAGQA 70:74) binding
- N99 (≠ A91) binding
- S124 (= S116) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y141) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K145) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (≠ P170) binding
Sites not aligning to the query:
- 299 Y→C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
32% identity, 56% coverage: 4:182/318 of query aligns to 2:190/338 of 1udaA
- active site: S124 (= S116), A125 (≠ I117), T126 (≠ G118), Y149 (= Y141), K153 (= K145), M189 (≠ F181)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (≠ F13), I12 (≠ V14), D31 (≠ G33), N32 (≠ R34), L33 (≠ G35), C34 (≠ G36), N35 (= N37), S36 (≠ L38), D58 (= D50), I59 (≠ L51), F80 (≠ L70), A81 (= A71), G82 (= G72), K84 (≠ A74), S122 (≠ V114), Y149 (= Y141), K153 (= K145), Y177 (≠ P169), P180 (≠ V172)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ G118), N179 (≠ L171)
Sites not aligning to the query:
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
32% identity, 56% coverage: 4:182/318 of query aligns to 2:190/338 of 1naiA
- active site: S124 (= S116), A125 (≠ I117), T126 (≠ G118), Y149 (= Y141), K153 (= K145), M189 (≠ F181)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (≠ F13), I12 (≠ V14), D31 (≠ G33), N32 (≠ R34), L33 (≠ G35), C34 (≠ G36), N35 (= N37), S36 (≠ L38), D58 (= D50), I59 (≠ L51), F80 (≠ L70), A81 (= A71), G82 (= G72), K84 (≠ A74), Y149 (= Y141), K153 (= K145), Y177 (≠ P169), P180 (≠ V172)
- binding 1,3-propandiol: N35 (= N37), K84 (≠ A74)
- binding uridine-5'-diphosphate: N179 (≠ L171)
Sites not aligning to the query:
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
32% identity, 56% coverage: 4:182/318 of query aligns to 2:190/338 of 1lrjA
- active site: S124 (= S116), A125 (≠ I117), T126 (≠ G118), Y149 (= Y141), K153 (= K145), M189 (≠ F181)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (≠ F13), I12 (≠ V14), D31 (≠ G33), N32 (≠ R34), L33 (≠ G35), C34 (≠ G36), N35 (= N37), S36 (≠ L38), D58 (= D50), I59 (≠ L51), F80 (≠ L70), A81 (= A71), G82 (= G72), K84 (≠ A74), Y149 (= Y141), K153 (= K145), Y177 (≠ P169), P180 (≠ V172)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (≠ K77), S124 (= S116), F178 (≠ P170), N179 (≠ L171)
Sites not aligning to the query:
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
31% identity, 56% coverage: 4:182/318 of query aligns to 2:190/338 of 1kvrA
- active site: A124 (≠ S116), A125 (≠ I117), T126 (≠ G118), Y149 (= Y141), K153 (= K145), M189 (≠ F181)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (≠ F13), I12 (≠ V14), D31 (≠ G33), N32 (≠ R34), C34 (≠ G36), N35 (= N37), S36 (≠ L38), D58 (= D50), I59 (≠ L51), F80 (≠ L70), A81 (= A71), G82 (= G72), K84 (≠ A74), S122 (≠ V114), S123 (= S115), Y149 (= Y141), K153 (= K145), Y177 (≠ P169), P180 (≠ V172)
- binding uridine-5'-diphosphate: N179 (≠ L171)
Sites not aligning to the query:
- binding uridine-5'-diphosphate: 198, 199, 200, 216, 217, 218, 231, 233, 269, 292, 295
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
31% identity, 56% coverage: 4:182/318 of query aligns to 2:190/338 of 1a9yA
- active site: A124 (≠ S116), A125 (≠ I117), T126 (≠ G118), F149 (≠ Y141), K153 (= K145)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (≠ F13), I12 (≠ V14), D31 (≠ G33), N32 (≠ R34), C34 (≠ G36), N35 (= N37), S36 (≠ L38), D58 (= D50), I59 (≠ L51), F80 (≠ L70), A81 (= A71), G82 (= G72), K84 (≠ A74), S122 (≠ V114), S123 (= S115), F149 (≠ Y141), K153 (= K145), Y177 (≠ P169), P180 (≠ V172)
- binding uridine-5'-diphosphate-glucose: A125 (≠ I117), T126 (≠ G118), N179 (≠ L171)
Sites not aligning to the query:
6kvcA Moee5 in complex with udp-glucose and NAD (see paper)
33% identity, 75% coverage: 5:244/318 of query aligns to 3:239/299 of 6kvcA
- active site: S109 (= S116), S110 (≠ I117), S111 (≠ G118), Y132 (= Y141), K136 (= K145)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (≠ V14), D31 (≠ G33), R32 (= R34), R33 (≠ G35), D46 (= D50), L47 (= L51), L65 (= L70), A66 (= A71), A67 (≠ G72), P69 (≠ A74), A107 (≠ V114), S109 (= S116), K136 (= K145), F161 (≠ P169), T163 (≠ L171), V164 (= V172), R170 (≠ A177), M173 (≠ N180)
- binding uridine-5'-diphosphate-glucose: P69 (≠ A74), R72 (≠ K77), S109 (= S116), S110 (≠ I117), Y132 (= Y141), T163 (≠ L171), M173 (≠ N180), F174 (= F181), R177 (vs. gap), E189 (≠ P195), I190 (vs. gap), Y191 (≠ F196), Q196 (≠ N201), R198 (= R203)
Sites not aligning to the query:
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
26% identity, 93% coverage: 4:299/318 of query aligns to 2:294/313 of 6bwlA
- active site: T122 (≠ S116), C123 (≠ I117), M124 (≠ G118), Y147 (= Y141), K151 (= K145)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (≠ V14), D31 (≠ G33), N32 (≠ R34), L33 (≠ G35), N35 (= N37), S36 (≠ L38), D57 (= D50), I58 (≠ L51), L79 (= L70), A80 (= A71), A81 (≠ G72), I83 (≠ A74), M120 (≠ V114), K151 (= K145), N176 (≠ L171), T177 (≠ V172)
- binding uridine-5'-diphosphate: N176 (≠ L171), G189 (≠ S183), V190 (≠ L184), N205 (≠ P193), I206 (≠ L194), Y207 (≠ F196), Q212 (≠ N201), R214 (= R203), I250 (≠ M250), E275 (= E275)
6kv9A Moee5 in complex with udp-glucuronic acid and NAD (see paper)
33% identity, 75% coverage: 5:244/318 of query aligns to 3:240/299 of 6kv9A
- active site: S110 (= S116), S111 (≠ I117), S112 (≠ G118), Y133 (= Y141), K137 (= K145)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (≠ V14), D31 (≠ G33), R32 (= R34), R33 (≠ L38), D47 (= D50), L48 (= L51), L66 (= L70), A67 (= A71), A68 (≠ G72), P70 (≠ A74), C85 (≠ A91), A108 (≠ V114), S109 (= S115), K137 (= K145), F162 (≠ P169), T164 (≠ L171), V165 (= V172), R171 (≠ A177), M174 (≠ N180)
- binding uridine-5'-diphosphate-glucuronic acid: P70 (≠ A74), R73 (≠ K77), S110 (= S116), S111 (≠ I117), Y133 (= Y141), T164 (≠ L171), R171 (≠ A177), M174 (≠ N180), F175 (= F181), R178 (vs. gap), E190 (≠ P195), I191 (vs. gap), Y192 (≠ F196), Q197 (≠ N201), R199 (= R203), V235 (≠ T239)
Sites not aligning to the query:
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
37% identity, 52% coverage: 5:168/318 of query aligns to 3:159/328 of 4id9B
- active site: S107 (= S116), Y133 (= Y141), K137 (= K145)
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), R11 (≠ F13), V12 (= V14), D31 (≠ N37), L32 (= L38), S45 (≠ E52), L46 (≠ T53), L65 (= L70), A67 (≠ Q73), V82 (≠ A91), Y133 (= Y141), K137 (= K145)
Sites not aligning to the query:
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
37% identity, 52% coverage: 5:168/318 of query aligns to 2:158/321 of 4id9A
- active site: S106 (= S116), Y132 (= Y141), K136 (= K145)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), R10 (≠ F13), V11 (= V14), D30 (≠ N37), L31 (= L38), R32 (≠ T39), S44 (≠ E52), L45 (≠ T53), L64 (= L70), A66 (≠ Q73), V81 (≠ A91), S106 (= S116), Y132 (= Y141), K136 (= K145)
Sites not aligning to the query:
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
25% identity, 79% coverage: 4:253/318 of query aligns to 2:264/314 of 6zldA
- active site: T126 (≠ S116), S127 (≠ I117), S128 (≠ G118), Y149 (= Y141), K153 (= K145)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (≠ V14), D32 (≠ G33), H33 (vs. gap), F34 (vs. gap), I35 (vs. gap), K43 (≠ R34), D62 (= D50), I63 (≠ L51), L81 (= L70), A82 (= A71), A83 (≠ G72), I124 (≠ V114), T126 (≠ S116), K153 (= K145), Y176 (≠ P169), T178 (≠ L171), R185 (≠ P178), M188 (vs. gap)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ A74), R88 (≠ G78), T126 (≠ S116), S127 (≠ I117), S128 (≠ G118), Y149 (= Y141), F177 (≠ P170), T178 (≠ L171), R185 (≠ P178), M188 (vs. gap), A189 (vs. gap), R192 (≠ S183), T204 (≠ P195), F206 (= F196), Q211 (≠ N201), R213 (= R203), I250 (≠ T239)
Sites not aligning to the query:
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
25% identity, 79% coverage: 4:253/318 of query aligns to 2:264/314 of 6zl6A
- active site: T126 (≠ S116), S127 (≠ I117), S128 (≠ G118), Y149 (= Y141), K153 (= K145)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (≠ V14), D32 (≠ G33), H33 (vs. gap), F34 (vs. gap), I35 (vs. gap), K43 (≠ R34), D62 (= D50), I63 (≠ L51), L81 (= L70), A82 (= A71), A83 (≠ G72), I124 (≠ V114), T126 (≠ S116), K153 (= K145), Y176 (≠ P169), T178 (≠ L171), V179 (= V172), R185 (≠ P178), M188 (vs. gap)
- binding uridine-5'-diphosphate: T178 (≠ L171), A189 (vs. gap), R192 (≠ S183), T204 (≠ P195), F206 (= F196), Q211 (≠ N201), R213 (= R203), I250 (≠ T239)
Sites not aligning to the query:
Query Sequence
>GFF2442 FitnessBrowser__Marino:GFF2442
MENRVLVTGATGFVGRELCARLVSAGKDVVAVGRGGNLTGPSGLTYRQLDLETDDLQQLF
SGGIDAVVHLAGQAHGKGGSERQELDGFRRANVNVTLRLAEAAIQAGVRRFVFVSSIGVH
GTATKGRSISENTPFSPGSPYTQSKMEAEVELTRLFEGVGSSELAIVRPPLVYGAKAPGN
FGSLLRLANSPAPLPFGMCSNRRSLISVGTLADFLIACIQSTEAGNQAFVVADSSAVSTA
DIVSSLRRGMNRSERLIPVPSALVAAALRLIGKREMYTQLFCDLEIDNEKARRLDGWAPC
DNTRSELETVGKLFYESQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory