Comparing GFF2461 FitnessBrowser__Marino:GFF2461 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
32% identity, 90% coverage: 11:242/258 of query aligns to 7:240/255 of 5yhtA
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
32% identity, 90% coverage: 11:242/258 of query aligns to 8:241/256 of 5zonA
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 90% coverage: 11:242/258 of query aligns to 10:243/260 of P95189
2p3nA Thermotoga maritima impase tm1415 (see paper)
28% identity, 79% coverage: 40:243/258 of query aligns to 38:232/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 79% coverage: 40:243/258 of query aligns to 38:232/256 of O33832
Q9K4B1 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
31% identity, 80% coverage: 28:234/258 of query aligns to 30:240/266 of Q9K4B1
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 82% coverage: 31:242/258 of query aligns to 35:251/271 of Q9M8S8
1jp4A Crystal structure of an enzyme displaying both inositol-polyphosphate 1-phosphatase and 3'-phosphoadenosine-5'-phosphate phosphatase activities (see paper)
30% identity, 60% coverage: 86:240/258 of query aligns to 110:269/302 of 1jp4A
Sites not aligning to the query:
Q9Z1N4 3'(2'),5'-bisphosphate nucleotidase 1; Bisphosphate 3'-nucleotidase 1; PAP-inositol 1,4-phosphatase; PIP; scHAL2 analogous 3; EC 3.1.3.7 from Rattus norvegicus (Rat) (see paper)
30% identity, 60% coverage: 86:240/258 of query aligns to 116:275/308 of Q9Z1N4
Sites not aligning to the query:
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 47% coverage: 13:133/258 of query aligns to 93:211/346 of Q6NPM8
Q9NX62 Golgi-resident adenosine 3',5'-bisphosphate 3'-phosphatase; Golgi-resident PAP phosphatase; gPAPP; 3'(2'), 5'-bisphosphate nucleotidase 2; Inositol monophosphatase domain-containing protein 1; Myo-inositol monophosphatase A3; Phosphoadenosine phosphate 3'-nucleotidase; EC 3.1.3.7 from Homo sapiens (Human) (see 2 papers)
24% identity, 70% coverage: 71:250/258 of query aligns to 163:338/359 of Q9NX62
Sites not aligning to the query:
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
26% identity, 90% coverage: 1:232/258 of query aligns to 3:236/270 of 6ib8B
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
26% identity, 88% coverage: 6:232/258 of query aligns to 4:232/267 of P0ADG4
Sites not aligning to the query:
5dw8A Crystal structure of 2'amp bound saimpase-ii
27% identity, 76% coverage: 40:235/258 of query aligns to 29:222/260 of 5dw8A
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
26% identity, 88% coverage: 6:232/258 of query aligns to 4:232/262 of 2qflA
6tqoT Rrn anti-termination complex (see paper)
26% identity, 86% coverage: 10:232/258 of query aligns to 4:224/255 of 6tqoT
5j16A Crystal structure of inositol monophosphate bound saimpase-ii
27% identity, 76% coverage: 41:235/258 of query aligns to 26:218/258 of 5j16A
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
28% identity, 93% coverage: 4:243/258 of query aligns to 1:240/258 of 3lv0A
2wefA Human 3'(2'), 5'-bisphosphate nucleotidase 1 (bpnt1) in complex with amp, po4 and magnesium
29% identity, 60% coverage: 86:239/258 of query aligns to 111:269/303 of 2wefA
Sites not aligning to the query:
5eq8A Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol (see paper)
29% identity, 52% coverage: 2:134/258 of query aligns to 4:126/259 of 5eq8A
Sites not aligning to the query:
>GFF2461 FitnessBrowser__Marino:GFF2461
MHYSSILPDVIKVADAASEKVLHIYQSDFKVSYKADASPITAADTAAHDIITHGLRSISR
DIPILSEEGSDIPWEERKHWRRFWLVDPVDGTKDFTQRTGEFTVNIAMIEDGQPVMGVVI
APALKEAFWGIVGEGAHMRDRTGRVHHIRVAEPKPLKRVVASKNHLNEETRAFIEALGDH
ELVQAGSSLKLCRIAEGHADIYPRLGPTSEWDTGAAQAVLMAAGGKVQTLDGEPLKYGKQ
NVLNPYFVASGSWYSPRP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory