SitesBLAST
Comparing GFF2518 FitnessBrowser__Phaeo:GFF2518 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7yleA Rndmpx in complex with dmsp (see paper)
65% identity, 93% coverage: 22:319/320 of query aligns to 1:298/299 of 7yleA
4xz6A Tmox in complex with tmao (see paper)
23% identity, 88% coverage: 26:308/320 of query aligns to 6:290/291 of 4xz6A
- binding calcium ion: P207 (= P235), V209 (= V237), N212 (≠ Y240), A215 (= A243), D218 (vs. gap)
- binding trimethylamine oxide: W13 (= W33), W60 (= W82), F64 (vs. gap), E89 (= E111), W135 (= W150), F178 (= F198), W180 (= W200)
Q5LT66 Trimethylamine N-oxide-binding protein; TMAO-binding protein from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
23% identity, 88% coverage: 26:308/320 of query aligns to 48:332/333 of Q5LT66
- W55 (= W33) binding ; mutation to A: Nearly complete abrogation of the TMAO-binding affinity.; mutation to F: Significant decrease in the TMAO-binding affinity.
- W102 (= W82) binding ; mutation to A: Nearly complete abrogation of the TMAO-binding affinity.; mutation to F: Significant decrease in the TMAO-binding affinity.
- F106 (vs. gap) mutation to A: Decrease in the TMAO-binding affinity.
- E131 (= E111) binding ; mutation to A: Nearly complete abrogation of the TMAO-binding affinity.
- W177 (= W150) binding ; mutation to A: Nearly complete abrogation of the TMAO-binding affinity.; mutation to F: Significant decrease in the TMAO-binding affinity.
- F220 (= F198) mutation to A: Significant decrease in the TMAO-binding affinity.
- W222 (= W200) binding ; mutation to A: Significant decrease in the TMAO-binding affinity.; mutation to F: Decrease in the TMAO-binding affinity.
- P249 (= P235) binding
- V251 (= V237) binding
- N254 (≠ Y240) binding
- A257 (= A243) binding
- D260 (vs. gap) binding
Sites not aligning to the query:
Q4FL33 Trimethylamine N-oxide-binding protein; TMAO-binding protein from Pelagibacter ubique (strain HTCC1062) (see paper)
23% identity, 95% coverage: 1:303/320 of query aligns to 8:309/314 of Q4FL33
- W38 (= W33) mutation to A: Maintains a relatively high binding affinity toward TMAO.
- W85 (= W82) mutation to A: Severely decreases the binding affinity toward TMAO.
- F89 (vs. gap) mutation to A: Severely decreases the binding affinity toward TMAO.
- E114 (≠ S106) mutation to A: Abolishes the binding affinity toward TMAO.
- F210 (= F198) mutation to A: Maintains a relatively high binding affinity toward TMAO.
- W212 (= W200) mutation to A: Severely decreases the binding affinity toward TMAO.
Query Sequence
>GFF2518 FitnessBrowser__Phaeo:GFF2518
MKQLVLASVCALGMAAPAWAEDCGDVTITQMDWASANVVTSVAKFLMEQGYGCSVTTVPS
STPTALTSVAETGTPDILTELWVNTAPAYADLVAEGKLVELADVLSDGGIEGWWVPQYVV
DAHPEAATLEGILANPKLVGGRFDNCPDGWGCRTVNDNMNQVIDMEGKGIEVFDHGSGET
LATAIAAAYADEKPWFGFYWAPTAVLGKFPMVLVDLGKYDADTHTCNSSKECASPGVSPY
PSAAVKTAATADFQQREPEIAELMSNISFTNDQMNGVLAWMEDNNASAEEGAVYFLTNNK
DQWGGWLNDEAHEKLSAILK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory