Comparing GFF260 FitnessBrowser__WCS417:GFF260 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
70% identity, 98% coverage: 2:287/291 of query aligns to 1:286/294 of 4ho9A
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
70% identity, 98% coverage: 2:287/291 of query aligns to 1:286/289 of 4ho4A
4ho6A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-glucose and utp
70% identity, 98% coverage: 2:287/291 of query aligns to 1:286/288 of 4ho6A
4ho5A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with tdp-glucose
70% identity, 98% coverage: 2:287/291 of query aligns to 1:286/288 of 4ho5A
4ho3A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine triphosphate
70% identity, 98% coverage: 2:287/291 of query aligns to 1:286/288 of 4ho3A
4hocA Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n- acetylglucosamine
70% identity, 98% coverage: 2:287/291 of query aligns to 1:284/286 of 4hocA
P61887 Glucose-1-phosphate thymidylyltransferase 2; G1P-TT 2; dTDP-glucose pyrophosphorylase 2; dTDP-glucose synthase 2; EC 2.7.7.24 from Escherichia coli (strain K12) (see paper)
67% identity, 98% coverage: 2:286/291 of query aligns to 1:285/293 of P61887
1mc3A Crystal structure of rffh (see paper)
67% identity, 98% coverage: 2:286/291 of query aligns to 2:286/291 of 1mc3A
1lvwA Crystal structure of glucose-1-phosphate thymidylyltransferase, rmla, complex with dtdp
67% identity, 99% coverage: 2:290/291 of query aligns to 4:292/295 of 1lvwA
4b5bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
65% identity, 99% coverage: 3:290/291 of query aligns to 4:291/293 of 4b5bA
4b4gA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
65% identity, 99% coverage: 3:290/291 of query aligns to 4:291/293 of 4b4gA
4b42A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
65% identity, 99% coverage: 3:290/291 of query aligns to 4:291/293 of 4b42A
4b3uA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
65% identity, 99% coverage: 3:290/291 of query aligns to 10:297/299 of 4b3uA
4asyA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
65% identity, 99% coverage: 3:290/291 of query aligns to 4:291/293 of 4asyA
4b4mA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
65% identity, 99% coverage: 3:290/291 of query aligns to 7:294/296 of 4b4mA
4asjA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
65% identity, 99% coverage: 3:290/291 of query aligns to 3:290/292 of 4asjA
1g3lA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Tdp-l-rhamnose complex. (see paper)
65% identity, 99% coverage: 3:290/291 of query aligns to 3:290/292 of 1g3lA
1g2vA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Ttp complex. (see paper)
65% identity, 99% coverage: 3:290/291 of query aligns to 3:290/292 of 1g2vA
1g1lA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Tdp-glucose complex. (see paper)
65% identity, 99% coverage: 3:290/291 of query aligns to 3:290/292 of 1g1lA
Sites not aligning to the query:
1g0rA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Thymidine/glucose- 1-phosphate complex. (see paper)
65% identity, 99% coverage: 3:290/291 of query aligns to 3:290/292 of 1g0rA
>GFF260 FitnessBrowser__WCS417:GFF260
MMKGIVLAGGSGTRLHPITLGVSKQLLPVYDKPMIYYPISVLMLAGIKDILVISTPVDLP
QYRNLLGDGSQFGVRFSYAEQPTPDGLAQAFIIGEEFIGDDPVCLILGDNIFHGQHFGEQ
LLGAAKRASGATVFGYWVKDPERFGVIDFDSEGRALSIEEKPAKPKSSYAVTGLYFYDND
VIKIAKAVKPSPRGEYEITDVNNAYLKRGDLHVERFGRGFAWLDTGTHDSLLEASQYVQT
IEHRQGLKVACLEEVAYENGWINREHLLERAKYFGKTGYGQYLYSLAGENQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory