Comparing GFF2617 FitnessBrowser__WCS417:GFF2617 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
41% identity, 95% coverage: 5:316/328 of query aligns to 4:317/337 of Q3L181
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
39% identity, 91% coverage: 5:304/328 of query aligns to 4:273/287 of 3v0sA
O14295 Pyridoxal reductase; PL reductase; PL-red; EC 1.1.1.65 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 95% coverage: 10:322/328 of query aligns to 5:327/333 of O14295
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
31% identity, 92% coverage: 6:308/328 of query aligns to 5:310/331 of P80874
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
35% identity, 88% coverage: 12:298/328 of query aligns to 23:279/286 of 8hnqA
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
31% identity, 92% coverage: 6:308/328 of query aligns to 5:310/333 of 1pz1A
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
31% identity, 92% coverage: 7:309/328 of query aligns to 6:310/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
31% identity, 92% coverage: 7:309/328 of query aligns to 5:309/311 of 1pz0A
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
33% identity, 87% coverage: 8:291/328 of query aligns to 17:303/335 of 4aubB
Sites not aligning to the query:
3n6qD Crystal structure of yghz from e. Coli (see paper)
32% identity, 87% coverage: 8:291/328 of query aligns to 18:290/315 of 3n6qD
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
35% identity, 80% coverage: 6:267/328 of query aligns to 5:275/323 of 6ow0A
Sites not aligning to the query:
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
31% identity, 96% coverage: 2:317/328 of query aligns to 1:326/326 of P77256
4aubE The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
31% identity, 87% coverage: 8:291/328 of query aligns to 18:278/297 of 4aubE
Sites not aligning to the query:
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
29% identity, 92% coverage: 7:307/328 of query aligns to 7:287/298 of 1ynqB
Sites not aligning to the query:
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
29% identity, 92% coverage: 7:307/328 of query aligns to 7:287/298 of 1ynpB
Sites not aligning to the query:
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
32% identity, 86% coverage: 8:289/328 of query aligns to 19:293/315 of 5t79A
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
32% identity, 86% coverage: 8:289/328 of query aligns to 18:288/312 of 3erpA
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
35% identity, 80% coverage: 6:267/328 of query aligns to 5:251/301 of 6ow0B
Sites not aligning to the query:
6hg6A Clostridium beijerinckii aldo-keto reductase cbei_3974 with NADPH (see paper)
30% identity, 86% coverage: 8:289/328 of query aligns to 18:291/313 of 6hg6A
4aubF The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
31% identity, 87% coverage: 8:291/328 of query aligns to 17:280/298 of 4aubF
>GFF2617 FitnessBrowser__WCS417:GFF2617
MVSTITLGTQGLQVGRIGLGCMGMSQWYGATDDNESLRTLHRALELGVNFFDSAEAYGPF
TNERLLQRAFAGRRGEVVIATKFGFRIVDGQIVGVDSSESNLQRVVEASLKRLGTDYIDV
LYQHRLDPTVPIEEVVGAMGRLVEQGKVKYLGLCEVGTRTIERAHATHPISVIQGEYSLW
ERNVEQEILPLLHNLGIGYVAFCPLGRGFLTGKAASATHYDANDFRQQDPRFREENFAAN
TFLTESILALADSWSMTPAQLALAWLLTRSPHLAVIPGTKRVAYLEENVAADACVLNDEQ
SHAIQALLGQWAVAGERYEQRMMQFIDR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory