Comparing GFF2620 FitnessBrowser__Phaeo:GFF2620 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
33% identity, 83% coverage: 41:263/270 of query aligns to 8:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
33% identity, 83% coverage: 41:265/270 of query aligns to 8:225/225 of 4zv2A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
32% identity, 80% coverage: 47:263/270 of query aligns to 20:228/229 of 5t0wA
Sites not aligning to the query:
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 84% coverage: 37:263/270 of query aligns to 1:220/231 of 2q2cA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 84% coverage: 37:263/270 of query aligns to 5:224/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 84% coverage: 37:263/270 of query aligns to 11:230/241 of 2q2aA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
27% identity, 84% coverage: 37:263/270 of query aligns to 3:221/226 of 8eyzA
3i6vA Crystal structure of a periplasmic his/glu/gln/arg/opine family- binding protein from silicibacter pomeroyi in complex with lysine
29% identity, 84% coverage: 39:265/270 of query aligns to 2:213/218 of 3i6vA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
27% identity, 84% coverage: 39:265/270 of query aligns to 12:229/229 of 6svfA
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
26% identity, 85% coverage: 36:265/270 of query aligns to 12:241/246 of 4ohnA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
25% identity, 85% coverage: 38:267/270 of query aligns to 5:230/234 of 3k4uE
2pyyB Crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate (see paper)
27% identity, 75% coverage: 62:263/270 of query aligns to 19:210/217 of 2pyyB
Sites not aligning to the query:
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
25% identity, 85% coverage: 34:263/270 of query aligns to 11:234/235 of 4g4pA
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
23% identity, 84% coverage: 37:263/270 of query aligns to 3:249/259 of 5ovzA
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
23% identity, 84% coverage: 37:263/270 of query aligns to 2:248/256 of 5otcA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
23% identity, 84% coverage: 37:263/270 of query aligns to 2:248/254 of 5otaA
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
23% identity, 84% coverage: 37:263/270 of query aligns to 2:248/254 of 5ot9A
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
23% identity, 84% coverage: 37:263/270 of query aligns to 2:248/254 of 4powA
5l9oA Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
30% identity, 76% coverage: 58:263/270 of query aligns to 30:229/241 of 5l9oA
5lomB Crystal structure of the pbp soca from agrobacterium tumefaciens c58 in complex with dfg at 1.5 a resolution (see paper)
30% identity, 76% coverage: 58:263/270 of query aligns to 32:231/250 of 5lomB
>GFF2620 FitnessBrowser__Phaeo:GFF2620
MTFIWTQTALKTVAATAGVALLASAATAADLPDLEGREVVVSVENAYPPLQFVEPSSGKA
IGWEYDAMAEIAERINITVVYETTSWDAMIPAVSDGQYDMGMTGITIRDDRKEKVDFSDK
YLTSQMRMIVAGDESRFDDAAGFAADADLLAGAQPGTTPFYVTVYDILDGDEANPRIKLF
ETFGAAIQALRTGDVDLALSDSTAANGYVQASDGALKIVGEPLGTEDFGFIFPKGSDLVA
PINAAIAAMEADGTLEALNTKWFLEYKLGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory