Comparing GFF2883 FitnessBrowser__Phaeo:GFF2883 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
1dcpA Dcoh, a bifunctional protein-binding transcriptional coactivator, complexed with biopterin (see paper)
51% identity, 96% coverage: 4:96/97 of query aligns to 2:94/99 of 1dcpA
P61459 Pterin-4-alpha-carbinolamine dehydratase; PHS; 4-alpha-hydroxy-tetrahydropterin dehydratase; Dimerization cofactor of hepatocyte nuclear factor 1-alpha; DCoH; Dimerization cofactor of HNF1; Phenylalanine hydroxylase-stimulating protein; Pterin carbinolamine dehydratase; PCD; EC 4.2.1.96 from Rattus norvegicus (Rat) (see 2 papers)
51% identity, 96% coverage: 4:96/97 of query aligns to 7:99/104 of P61459
Sites not aligning to the query:
P61457 Pterin-4-alpha-carbinolamine dehydratase; PHS; 4-alpha-hydroxy-tetrahydropterin dehydratase; Dimerization cofactor of hepatocyte nuclear factor 1-alpha; DCoH; Dimerization cofactor of HNF1; Phenylalanine hydroxylase-stimulating protein; Pterin carbinolamine dehydratase; PCD; EC 4.2.1.96 from Homo sapiens (Human) (see 6 papers)
51% identity, 96% coverage: 4:96/97 of query aligns to 7:99/104 of P61457
Sites not aligning to the query:
1f93A Crystal structure of a complex between the dimerization domain of hnf-1 alpha and the coactivator dcoh (see paper)
51% identity, 96% coverage: 4:96/97 of query aligns to 6:98/103 of 1f93A
2v6tB Crystal structure of a complex of pterin-4a-carbinolamine dehydratase from toxoplasma gondii with 7,8-dihydrobiopterin (see paper)
45% identity, 75% coverage: 22:94/97 of query aligns to 21:93/100 of 2v6tB
>GFF2883 FitnessBrowser__Phaeo:GFF2883
MTEKLSDATRGPLLDPLFSAGWQVVNGRDAITKTYKFDSFVDAFGWMTRAAIWAEKWDHH
PEWSNVYNTVTVTLTTHDVGGISALDAKLARKMESLF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory