Comparing GFF2909 FitnessBrowser__Marino:GFF2909 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
E4PMA5 Glucosylglycerol phosphorylase; GGoP; 2-O-alpha-D-glucopyranosylglycerol:phosphate alpha-D-glucosyltransferase; 2-O-alpha-D-glucosylglycerol phosphorylase (retaining); EC 2.4.1.359 from Marinobacter adhaerens (strain DSM 23420 / HP15) (see paper)
100% identity, 100% coverage: 1:480/480 of query aligns to 1:480/480 of E4PMA5
7xdqA Crystal structure of a glucosylglycerol phosphorylase mutant from marinobacter adhaerens
96% identity, 100% coverage: 3:480/480 of query aligns to 1:470/470 of 7xdqA
D9TT09 Sucrose 6(F)-phosphate phosphorylase; Sucrose 6'-phosphate phosphorylase; SPP; EC 2.4.1.329 from Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIMB 9385 / NCA 3814 / NCTC 13789 / WDCM 00135 / 2032) (Clostridium thermosaccharolyticum) (see 2 papers)
42% identity, 100% coverage: 1:478/480 of query aligns to 1:487/488 of D9TT09
P10249 Sucrose phosphorylase; Glucosyltransferase-A; GTF-A; Sucrose glucosyltransferase; EC 2.4.1.7 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
40% identity, 98% coverage: 1:469/480 of query aligns to 1:475/481 of P10249
Sites not aligning to the query:
7znpA Structure of amedsp
40% identity, 99% coverage: 3:478/480 of query aligns to 2:490/502 of 7znpA
A0ZZH6 Sucrose phosphorylase; SP; SPase; EC 2.4.1.7 from Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) (see paper)
38% identity, 93% coverage: 3:446/480 of query aligns to 1:455/504 of A0ZZH6
2gduA E232q mutant of sucrose phosphorylase from bifidobacterium adolescentis in complex with sucrose (see paper)
38% identity, 93% coverage: 3:446/480 of query aligns to 1:455/504 of 2gduA
5c8bB Structural insights into the redesign of a sucrose phosphorylase by induced loop repositioning (see paper)
38% identity, 93% coverage: 3:446/480 of query aligns to 1:455/504 of 5c8bB
5m9xB Structure of sucrose phosphorylase from bifidobacterium adolescentis bound to glycosylated resveratrol (see paper)
38% identity, 93% coverage: 3:446/480 of query aligns to 1:455/504 of 5m9xB
A0A6C7EEG6 Sucrose 6(F)-phosphate phosphorylase; SPP; Sucrose 6'-phosphate phosphorylase; EC 2.4.1.329 from Ilumatobacter coccineus (strain NBRC 103263 / KCTC 29153 / YM16-304) (see paper)
30% identity, 97% coverage: 3:467/480 of query aligns to 10:511/523 of A0A6C7EEG6
6s9uA Crystal structure of sucrose 6f-phosphate phosphorylase from ilumatobacter coccineus (see paper)
30% identity, 97% coverage: 3:467/480 of query aligns to 6:507/520 of 6s9uA
D7BAR0 Glucosylglycerate phosphorylase; GGa phosphorylase; GGaP; EC 2.4.1.352 from Allomeiothermus silvanus (strain ATCC 700542 / DSM 9946 / NBRC 106475 / NCIMB 13440 / VI-R2) (Thermus silvanus) (see paper)
30% identity, 87% coverage: 9:427/480 of query aligns to 54:489/555 of D7BAR0
Q9ZEU2 Amylosucrase; EC 2.4.1.4 from Neisseria polysaccharea (see 2 papers)
30% identity, 42% coverage: 1:203/480 of query aligns to 101:307/636 of Q9ZEU2
Sites not aligning to the query:
3ueqA Crystal structure of amylosucrase from neisseria polysaccharea in complex with turanose (see paper)
30% identity, 42% coverage: 1:203/480 of query aligns to 97:303/632 of 3ueqA
Sites not aligning to the query:
1s46A Covalent intermediate of the e328q amylosucrase mutant (see paper)
30% identity, 42% coverage: 1:203/480 of query aligns to 93:299/628 of 1s46A
Sites not aligning to the query:
1jgiA Crystal structure of the active site mutant glu328gln of amylosucrase from neisseria polysaccharea in complex with the natural substrate sucrose (see paper)
30% identity, 42% coverage: 1:203/480 of query aligns to 93:299/628 of 1jgiA
Sites not aligning to the query:
3czkA Crystal structure analysis of sucrose hydrolase(suh) e322q-sucrose complex (see paper)
29% identity, 43% coverage: 11:214/480 of query aligns to 91:298/618 of 3czkA
Sites not aligning to the query:
5x7uA Trehalose synthase from thermobaculum terrenum (see paper)
25% identity, 86% coverage: 32:443/480 of query aligns to 41:470/546 of 5x7uA
Sites not aligning to the query:
3uerA Crystal structure of amylosucrase from deinococcus geothermalis in complex with turanose (see paper)
26% identity, 43% coverage: 7:213/480 of query aligns to 97:311/651 of 3uerA
Sites not aligning to the query:
5gtwA The n253r mutant structures of trehalose synthase from deinococcus radiodurans display two different active-site conformations
27% identity, 41% coverage: 38:233/480 of query aligns to 46:267/548 of 5gtwA
Sites not aligning to the query:
>GFF2909 FitnessBrowser__Marino:GFF2909
MLLKNAVQLICYPDRIGNNLKDLYTVVDTHLSEAIGGLHILPFFPSNADGGFSPLTHKEV
DPKVGTWDDIEAFTAKYDLCVDLTVNHISDESPEFTDFIANGFDSEYADLFVHVDKFGEI
SPDDMAKIHIRKEKEPFREVTLSDGTKTRVWCTFTEQQIDLNYESDLAYQLMESYIGFLT
SKGVNLLRLDAFGYTTKRIGTSCFLVEPEVYQILDWVNQVALKHGAECLPEVHDHTSYQY
AISRRNMHPYGFALPPLLLYSLLDANSTYLKNWLRMCPRNMVTVLDTHDGICIPDVEGVL
PDEKIKVLIDNIDARSADPIMRRSAANIHSVGAIYQLTCTFYDALMQNDDAYIAARAIQF
FTPGIPQVYYVGLLAGCNDHELMEQSGELRDINRHYYTLEEVEQDIQKPVVQRLLSLMKF
RSNYPAFDGHFELNYSNNSSVAMAWRHGDYYCHLFVDLNFKTVKVTYTDVETGETRHLEC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory