SitesBLAST
Comparing GFF2911 FitnessBrowser__Marino:GFF2911 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
38% identity, 96% coverage: 9:255/256 of query aligns to 5:253/262 of 3pk0B
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
38% identity, 95% coverage: 9:252/256 of query aligns to 2:254/258 of 3ak4A
- active site: G18 (= G25), S141 (= S145), L151 (≠ T155), Y154 (= Y158), K158 (= K162), E199 (≠ D199)
- binding nicotinamide-adenine-dinucleotide: K17 (= K24), G18 (= G25), I19 (= I26), D38 (≠ S50), L39 (= L51), V60 (≠ C70), D61 (= D71), V62 (≠ I72), N88 (≠ S100), A89 (= A101), G90 (vs. gap), T139 (≠ I143), S141 (= S145), Y154 (= Y158), K158 (= K162), G185 (= G189), V187 (≠ I191), T189 (≠ F193), M191 (≠ G195)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
33% identity, 95% coverage: 12:255/256 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G25), S142 (= S145), Q152 (≠ T155), Y155 (= Y158), K159 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G21), S14 (= S23), R15 (≠ K24), G16 (= G25), I17 (= I26), N35 (≠ C44), Y36 (≠ A45), N37 (≠ R46), G38 (= G47), S39 (≠ Q48), N63 (≠ D71), V64 (≠ I72), N90 (≠ C98), A91 (= A99), I93 (≠ F102), I113 (≠ V117), S142 (= S145), Y155 (= Y158), K159 (= K162), P185 (= P188), I188 (= I191), T190 (≠ W198)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
38% identity, 96% coverage: 12:256/256 of query aligns to 3:239/240 of 2d1yA
- active site: G16 (= G25), S135 (= S145), N145 (≠ T155), Y148 (= Y158), K152 (= K162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), R15 (≠ K24), I17 (= I26), D36 (≠ S50), L37 (= L51), R38 (≠ D52), V55 (≠ C70), D56 (= D71), L57 (≠ I72), N83 (≠ C98), A84 (= A99), A85 (vs. gap), I86 (vs. gap), V133 (≠ I143), S135 (= S145), Y148 (= Y158), K152 (= K162), P178 (= P188), G179 (= G189), I181 (= I191), T183 (≠ F193), A185 (≠ G195), V186 (≠ G196)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
36% identity, 95% coverage: 9:252/256 of query aligns to 1:248/252 of 1vl8B
- active site: G17 (= G25), S143 (= S145), I154 (≠ T155), Y157 (= Y158), K161 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G21), R16 (≠ K24), G17 (= G25), L18 (≠ I26), S37 (≠ A45), R38 (= R46), C63 (= C70), D64 (= D71), V65 (≠ I72), A91 (≠ C98), A92 (= A99), G93 (≠ S100), I94 (≠ A101), V114 (= V117), I141 (= I143), S143 (= S145), Y157 (= Y158), K161 (= K162), P187 (= P188), G188 (= G189), Y190 (≠ D199), T192 (≠ A201), M194 (≠ Q203), T195 (vs. gap)
2zatA Crystal structure of a mammalian reductase (see paper)
34% identity, 94% coverage: 12:252/256 of query aligns to 3:246/251 of 2zatA
- active site: G16 (= G25), S142 (= S145), L152 (≠ T155), Y155 (= Y158), K159 (= K162), K200 (≠ Q200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A12 (≠ G21), T14 (≠ S23), D15 (≠ K24), G16 (= G25), I17 (= I26), S36 (≠ A45), R37 (= R46), K38 (≠ G47), N41 (≠ S50), H62 (≠ D71), N89 (≠ C98), A91 (≠ S100), V140 (≠ I143), S142 (= S145), Y155 (= Y158), K159 (= K162), P185 (= P188), G186 (= G189), I188 (= I191), T190 (vs. gap), F192 (= F193), S193 (≠ P194)
Q8WNV7 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; PHCR; NADPH-dependent retinol dehydrogenase/reductase; NDRD; Peroxisomal carbonyl reductase; PerCR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; EC 1.1.1.184; EC 1.1.1.300 from Sus scrofa (Pig) (see 2 papers)
35% identity, 92% coverage: 18:252/256 of query aligns to 37:274/279 of Q8WNV7
- 37:61 (vs. 18:42, 44% identical) binding
- F177 (≠ S152) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to S: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with F-180.
- L180 (≠ T155) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to F: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with S-177.
- Y183 (= Y158) active site, Proton acceptor
- K187 (= K162) binding
- N196 (≠ S171) Important for the maintenance of the quaternary structure, the catalytic activity and cold stability
Sites not aligning to the query:
- 277:279 Peroxisomal targeting signal
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
33% identity, 94% coverage: 15:255/256 of query aligns to 5:246/246 of 3osuA
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
35% identity, 96% coverage: 10:255/256 of query aligns to 1:243/244 of 6t77A
- active site: G16 (= G25), S138 (= S145), Y151 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G21), S14 (= S23), R15 (≠ K24), T37 (≠ R46), L58 (= L65), N59 (≠ H66), V60 (= V67), A87 (= A99), G88 (vs. gap), I89 (vs. gap)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
35% identity, 97% coverage: 4:252/256 of query aligns to 1:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G21), S20 (= S23), K21 (= K24), G22 (= G25), I23 (= I26), A43 (= A45), S44 (≠ R46), S45 (≠ G47), G68 (≠ C70), D69 (= D71), V70 (≠ I72), N96 (≠ C98), S97 (≠ A99), G98 (≠ S100), Y100 (≠ F102), I144 (= I143), S146 (= S145), Y159 (= Y158), K163 (= K162), P189 (= P188), G190 (= G189), M191 (≠ S190), I192 (= I191), T194 (≠ F193), G196 (= G195), T197 (≠ W198)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S145), Y159 (= Y158), M191 (≠ S190), I202 (≠ Q203)
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
34% identity, 92% coverage: 18:252/256 of query aligns to 12:249/254 of 3o4rA
- active site: G19 (= G25), S145 (= S145), F155 (≠ T155), Y158 (= Y158), K162 (= K162), K203 (≠ Q200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G21), T17 (≠ S23), D18 (≠ K24), G19 (= G25), I20 (= I26), S39 (≠ A45), R40 (= R46), K41 (≠ G47), N44 (≠ S50), H65 (≠ D71), V66 (≠ I72), N92 (≠ C98), A94 (≠ S100), S145 (= S145), Y158 (= Y158), K162 (= K162), P188 (= P188), G189 (= G189), L190 (≠ S190), I191 (= I191), T193 (vs. gap), F195 (= F193), S196 (≠ P194)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 97% coverage: 7:255/256 of query aligns to 1:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G21), S17 (= S23), R18 (≠ K24), I20 (= I26), T40 (≠ R46), N62 (≠ H66), V63 (= V67), N89 (≠ C98), A90 (= A99), I92 (≠ F102), V139 (≠ I143), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P188), G185 (= G189), I187 (= I191), T189 (≠ W198), M191 (≠ Q200)
3toxA Crystal structure of a short chain dehydrogenase in complex with NAD(p) from sinorhizobium meliloti 1021
36% identity, 94% coverage: 12:252/256 of query aligns to 3:249/254 of 3toxA
- active site: G16 (= G25), S142 (≠ I146), V153 (≠ T155), Y156 (= Y158), K160 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G21), S14 (= S23), S15 (≠ K24), G16 (= G25), I17 (= I26), A36 (= A45), R37 (= R46), N38 (≠ G47), V63 (≠ I72), N89 (≠ C98), A90 (= A99), G91 (≠ S100), T140 (≠ A144), S142 (≠ I146), Y156 (= Y158), K160 (= K162), P186 (= P188), G188 (≠ S190), T189 (≠ I191), T191 (≠ F193)
1ahhA 7 alpha-hydroxysteroid dehydrogenase complexed with NAD+ (see paper)
33% identity, 95% coverage: 12:254/256 of query aligns to 9:251/253 of 1ahhA
- active site: G22 (= G25), S146 (= S145), M156 (≠ T155), Y159 (= Y158), K163 (= K162)
- binding nicotinamide-adenine-dinucleotide: G18 (= G21), A21 (≠ K24), D42 (≠ A45), I43 (≠ R46), C67 (= C70), D68 (= D71), I69 (= I72), N95 (≠ C98), G97 (≠ S100), T145 (≠ A144), Y159 (= Y158), K163 (= K162), P189 (= P188), G190 (= G189), I192 (= I191)
1ahiA 7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid (see paper)
33% identity, 95% coverage: 12:254/256 of query aligns to 9:251/255 of 1ahiA
- active site: G22 (= G25), S146 (= S145), M156 (≠ T155), Y159 (= Y158), K163 (= K162)
- binding glycochenodeoxycholic acid: S146 (= S145), A148 (= A147), N151 (≠ H150), Y159 (= Y158), A196 (≠ Q200), V200 (≠ N204)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G18 (= G21), A21 (≠ K24), G22 (= G25), I23 (= I26), D42 (≠ A45), I43 (≠ R46), D68 (= D71), I69 (= I72), N95 (≠ C98), Y159 (= Y158), K163 (= K162), P189 (= P188), G190 (= G189), I192 (= I191), T194 (≠ W198), A196 (≠ Q200)
Sites not aligning to the query:
P0AET8 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NAD-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.159 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 95% coverage: 12:254/256 of query aligns to 9:251/255 of P0AET8
- I23 (= I26) binding
- DI 42:43 (≠ AR 45:46) binding
- DI 68:69 (= DI 71:72) binding
- N95 (≠ C98) binding
- G99 (≠ F102) binding
- S146 (= S145) binding ; mutation S->A,H: Reduction of the catalytic efficiency by over 65%. No effect on the affinity for cholate and NAD.
- N151 (≠ H150) binding
- Y159 (= Y158) binding ; binding ; mutation to F: Loss of activity.; mutation to H: Reduction of the catalytic efficiency by 87.7%. No effect on the affinity for cholate and NAD.
- K163 (= K162) binding ; mutation to I: Reduction of the catalytic efficiency by 95%. No effect on the affinity for cholate and NAD.; mutation to R: Reduction of the catalytic efficiency by 35%. No effect on the affinity for cholate and NAD.
- I-----LT 192:194 (≠ IEFPGGVW 191:198) binding
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
35% identity, 96% coverage: 11:255/256 of query aligns to 1:242/243 of 1q7bA
- active site: G15 (= G25), E101 (= E109), S137 (= S145), Q147 (≠ T155), Y150 (= Y158), K154 (= K162)
- binding calcium ion: E232 (≠ Q245), T233 (= T246)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G21), S13 (= S23), R14 (≠ K24), T36 (≠ R46), N58 (≠ H66), V59 (= V67), N85 (≠ C98), A86 (= A99), G87 (vs. gap), I88 (vs. gap), S137 (= S145), Y150 (= Y158), K154 (= K162), P180 (= P188), G181 (= G189), I183 (= I191)
6zt2A 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with 3-chloro-2,6-difluorophenol
33% identity, 86% coverage: 34:252/256 of query aligns to 25:244/252 of 6zt2A
- binding beta-D-glucopyranose: W184 (≠ E192), T185 (≠ F193), P186 (= P194), E189 (≠ D199)
- binding nicotinamide-adenine-dinucleotide: D36 (≠ A45), K37 (≠ R46), D58 (= D71), V59 (≠ I72), N85 (≠ C98), L109 (≠ V117), S137 (= S145), Y150 (= Y158), K154 (= K162), P180 (= P188), G181 (= G189), N182 (≠ S190), I183 (= I191), T185 (≠ F193), L187 (≠ V197)
- binding 3-chloranyl-2,6-bis(fluoranyl)phenol: H89 (vs. gap), S137 (= S145), Y150 (= Y158), N182 (≠ S190), W188 (= W198)
Sites not aligning to the query:
6zdiA 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with 2-fluoro-5-nitrophenol
33% identity, 86% coverage: 34:252/256 of query aligns to 25:244/252 of 6zdiA
- active site: S137 (= S145), Y150 (= Y158), K154 (= K162)
- binding nicotinamide-adenine-dinucleotide: D36 (≠ A45), K37 (≠ R46), D58 (= D71), V59 (≠ I72), N85 (≠ C98), A86 (= A99), L109 (≠ V117), I135 (= I143), S137 (= S145), Y150 (= Y158), K154 (= K162), P180 (= P188), G181 (= G189), N182 (≠ S190), I183 (= I191), T185 (≠ F193), L187 (≠ V197)
- binding 2-fluoranyl-5-nitro-phenol: H89 (vs. gap), S137 (= S145), Y150 (= Y158), L187 (≠ V197), W188 (= W198), L191 (≠ A201)
Sites not aligning to the query:
6zdeA 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with pentafluorophenol
33% identity, 86% coverage: 34:252/256 of query aligns to 25:244/252 of 6zdeA
- active site: S137 (= S145), Y150 (= Y158), K154 (= K162)
- binding nicotinamide-adenine-dinucleotide: D36 (≠ A45), K37 (≠ R46), D58 (= D71), V59 (≠ I72), N85 (≠ C98), L109 (≠ V117), S137 (= S145), Y150 (= Y158), K154 (= K162), P180 (= P188), G181 (= G189), N182 (≠ S190), I183 (= I191), T185 (≠ F193), L187 (≠ V197)
- binding 2,3,4,5,6-pentakis(fluoranyl)phenol: H89 (vs. gap), S137 (= S145), Y150 (= Y158), L187 (≠ V197), W188 (= W198)
Sites not aligning to the query:
Query Sequence
>GFF2911 FitnessBrowser__Marino:GFF2911
MGKQEHSVMFDFHGRRVIVAGGSKGIGRAIALGFARAGASVSVCARGQASLDALAEEVAS
EGLALHVTPCDIGDKAELEAYLQNAMGELGGLDVLVNCASAFGREDNEEGWLSSVEVDLM
GTVRAGHICLPALKETGGTIINIASIAALHASTRTAPYAAIKAAVAHYTGSLAVTMAPHK
VRVNGIAPGSIEFPGGVWDQARQNNPELYQRIREGIPFGRLGTPEEVADVALFLASDLAR
WITGQTLVVDGGQVLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory