SitesBLAST
Comparing GFF2997 FitnessBrowser__WCS417:GFF2997 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wghA Crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with NADP and acetate at 1.8 a resolution
58% identity, 96% coverage: 11:273/273 of query aligns to 13:283/283 of 4wghA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G17), T20 (= T18), W21 (= W19), D49 (= D47), Y54 (= Y52), N142 (= N140), Q164 (= Q158), Y192 (= Y186), C193 (= C187), P194 (= P188), L195 (≠ I189), Q197 (= Q191), A198 (≠ G192), R200 (≠ E194), A223 (= A213), I239 (= I229), P240 (= P230), K241 (= K231), A242 (= A232), A243 (≠ V233), S244 (≠ T234), H247 (= H237), N251 (= N241)
6ciaA Crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with NADPH.
58% identity, 96% coverage: 11:273/273 of query aligns to 14:284/284 of 6ciaA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G17), T21 (= T18), W22 (= W19), D50 (= D47), Y55 (= Y52), H113 (= H110), N143 (= N140), Q165 (= Q158), Y193 (= Y186), C194 (= C187), P195 (= P188), L196 (≠ I189), Q198 (= Q191), A199 (≠ G192), A224 (= A213), I240 (= I229), P241 (= P230), K242 (= K231), A243 (= A232), A244 (≠ V233), S245 (≠ T234), H248 (= H237), N252 (= N241)
5c7hA Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with NADPH
56% identity, 97% coverage: 8:273/273 of query aligns to 13:281/281 of 5c7hA
- active site: D52 (= D47), Y57 (= Y52), K82 (= K77), H115 (= H110)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G17), T23 (= T18), W24 (= W19), D52 (= D47), Y57 (= Y52), H115 (= H110), Q167 (= Q158), Y195 (= Y186), S196 (≠ C187), P197 (= P188), L198 (≠ I189), E200 (≠ Q191), L204 (= L196), A221 (= A213), I237 (= I229), P238 (= P230), K239 (= K231), T240 (≠ A232), R245 (≠ H237), E248 (≠ L240), N249 (= N241), I281 (≠ V273)
4pmjA Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with NADP
56% identity, 97% coverage: 8:273/273 of query aligns to 13:281/281 of 4pmjA
- active site: D52 (= D47), Y57 (= Y52), K82 (= K77), H115 (= H110)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G17), T23 (= T18), W24 (= W19), D52 (= D47), H115 (= H110), Q167 (= Q158), Y195 (= Y186), S196 (≠ C187), P197 (= P188), L198 (≠ I189), E200 (≠ Q191), L204 (= L196), A221 (= A213), I237 (= I229), P238 (= P230), K239 (= K231), T240 (≠ A232), G241 (≠ V233), R245 (≠ H237), E248 (≠ L240), N249 (= N241)
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
42% identity, 93% coverage: 7:260/273 of query aligns to 10:274/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W22 (= W19), Y59 (= Y52), W87 (≠ Y79), H118 (= H110), R204 (≠ Q191)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G17), T21 (= T18), W22 (= W19), Y59 (= Y52), H118 (= H110), N149 (= N140), Q170 (= Q158), Y199 (= Y186), S200 (≠ C187), P201 (= P188), L202 (≠ I189), R204 (≠ Q191), T205 (≠ G192), Y227 (≠ A213), I243 (= I229), P244 (= P230), K245 (= K231), G247 (≠ V233), R248 (≠ T234), H251 (= H237), E254 (≠ L240), N255 (= N241)
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
42% identity, 93% coverage: 7:260/273 of query aligns to 10:274/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
42% identity, 93% coverage: 7:260/273 of query aligns to 9:273/274 of 5danA
- active site: D53 (= D47), Y58 (= Y52), K84 (= K77), H117 (= H110)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G17), T20 (= T18), W21 (= W19), D53 (= D47), Y58 (= Y52), H117 (= H110), Q169 (= Q158), Y198 (= Y186), S199 (≠ C187), P200 (= P188), L201 (≠ I189), R203 (≠ Q191), Y226 (≠ A213), I242 (= I229), P243 (= P230), K244 (= K231), G246 (≠ V233), R247 (≠ T234), H250 (= H237), E253 (≠ L240), N254 (= N241)
4gieA Crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to NADP (see paper)
32% identity, 92% coverage: 9:260/273 of query aligns to 21:270/288 of 4gieA
- active site: D55 (= D47), Y60 (= Y52), K85 (= K77), H118 (= H110)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G17), W31 (= W19), D55 (= D47), Y60 (= Y52), H118 (= H110), W119 (= W111), N148 (= N140), Q169 (≠ N162), W195 (≠ Y186), S196 (≠ C187), P197 (= P188), L198 (≠ I189), S200 (≠ Q191), L207 (= L196), A224 (= A213), I239 (= I229), P240 (= P230), K241 (= K231), S242 (≠ A232), R247 (≠ H237), E250 (≠ L240), N251 (= N241)
4fziA Crystal structure of prostaglandin f synthase from trypanosoma cruzi (see paper)
32% identity, 92% coverage: 9:260/273 of query aligns to 10:259/277 of 4fziA
A0QV10 Aldo-keto reductase MSMEG_2408/MSMEI_2347; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 92% coverage: 8:257/273 of query aligns to 10:255/275 of A0QV10
Sites not aligning to the query:
- 262 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
37% identity, 68% coverage: 7:192/273 of query aligns to 9:209/331 of P80874
Sites not aligning to the query:
- 214 binding
- 227 binding
- 280:282 binding
- 286 binding
1vbjA The crystal structure of prostaglandin f synthase from trypanosoma brucei
32% identity, 92% coverage: 8:258/273 of query aligns to 17:262/281 of 1vbjA
- active site: D52 (= D47), Y57 (= Y52), K82 (= K77), H115 (= H110)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G26 (= G17), M27 (≠ T18), W28 (= W19), D52 (= D47), Y57 (= Y52), H115 (= H110), N145 (= N140), Q166 (≠ N162), W192 (≠ Y186), S193 (≠ C187), P194 (= P188), L195 (≠ I189), Q197 (= Q191), G198 (= G193), V201 (≠ L196), A218 (= A213), I233 (= I229), K235 (= K231), S236 (≠ A232), G237 (≠ V233), R241 (≠ H237), E244 (≠ L240), N245 (= N241)
Q9GV41 9,11-endoperoxide prostaglandin H2 reductase; Prostaglandin F2-alpha synthase; EC 1.1.1.- from Trypanosoma brucei brucei
32% identity, 92% coverage: 8:258/273 of query aligns to 12:257/276 of Q9GV41
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
37% identity, 68% coverage: 7:192/273 of query aligns to 9:209/333 of 1pz1A
- active site: D52 (= D47), Y57 (= Y52), K90 (≠ P80), Q93 (≠ A83), H125 (= H110)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G17), W21 (= W19), Q175 (= Q158), Y203 (= Y186), G204 (≠ C187), L206 (≠ I189), R208 (≠ Q191)
Sites not aligning to the query:
4g5dA X-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to NADPH (see paper)
33% identity, 92% coverage: 8:258/273 of query aligns to 13:266/283 of 4g5dA
- active site: D48 (= D47), Y53 (= Y52), K78 (= K77), H111 (= H110)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G17), V23 (≠ T18), W24 (= W19), D48 (= D47), Y53 (= Y52), H111 (= H110), S148 (= S139), N149 (= N140), Q170 (= Q158), W196 (≠ Y186), S197 (≠ C187), P198 (= P188), L199 (≠ I189), Q201 (= Q191), G202 (= G193), L205 (= L196), I237 (= I229), P238 (= P230), K239 (= K231), S240 (≠ A232), V241 (= V233), H242 (≠ T234), R245 (≠ H237), E248 (≠ L240), N249 (= N241)
3d3fA Crystal structure of yvgn and cofactor NADPH from bacillus subtilis (see paper)
36% identity, 92% coverage: 8:258/273 of query aligns to 13:258/275 of 3d3fA
- active site: D48 (= D47), Y53 (= Y52), K78 (= K77), H111 (= H110)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G17), F24 (≠ W19), D48 (= D47), Y53 (= Y52), H111 (= H110), S140 (= S139), N141 (= N140), Q162 (= Q158), W188 (≠ Y186), S189 (≠ C187), P190 (= P188), L191 (≠ I189), Q193 (= Q191), L197 (= L196), I229 (= I229), K231 (= K231), S232 (≠ A232), K234 (≠ T234), R237 (≠ H237), E240 (≠ L240), N241 (= N241)
3wbwA Crystal structure of gox0644 in complex with NADPH
31% identity, 93% coverage: 8:260/273 of query aligns to 11:255/271 of 3wbwA
- active site: D45 (= D47), Y50 (= Y52), K71 (= K77), H104 (= H110)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G17), H104 (= H110), N136 (= N140), W183 (≠ Y186), R184 (≠ C187), P185 (= P188), L186 (≠ I189), L192 (= L196), A209 (= A213), K226 (= K231), S227 (≠ A232), V228 (= V233), R232 (≠ H237), E235 (≠ L240), N236 (= N241)
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
30% identity, 92% coverage: 8:258/273 of query aligns to 10:274/287 of 3v0sA
- active site: D45 (= D47), Y50 (= Y52), G87 (= G87), H119 (= H110)
- binding 2'-monophosphoadenosine-5'-diphosphate: S198 (≠ C187), P199 (= P188), I200 (= I189), G201 (≠ A190), L204 (= L195), P246 (= P230), G247 (≠ K231), T248 (≠ A232), T249 (≠ V233), N253 (≠ H237), N256 (≠ L240), N257 (= N241)
3b3dA B.Subtilis ytbe (see paper)
34% identity, 92% coverage: 8:258/273 of query aligns to 14:263/280 of 3b3dA
5az1A Crystal structure of aldo-keto reductase (akr2e5) complexed with nadph (see paper)
28% identity, 96% coverage: 8:270/273 of query aligns to 12:299/327 of 5az1A
- active site: D53 (= D47), Y58 (= Y52), K87 (= K77), H120 (= H110)
- binding calcium ion: R79 (= R69), L111 (≠ T101), D112 (= D102), H113 (≠ Y103)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G17), T22 (= T18), W23 (= W19), D53 (= D47), Y58 (= Y52), H120 (= H110), Q180 (= Q158), Y206 (= Y186), S207 (≠ C187), P208 (= P188), F209 (≠ I189), V213 (vs. gap), S215 (vs. gap), R216 (vs. gap), T243 (≠ A213), I258 (= I229), P259 (= P230), K260 (= K231), T261 (≠ A232), V262 (= V233), T263 (= T234), R266 (≠ H237), E269 (≠ L240), N270 (= N241)
Query Sequence
>GFF2997 FitnessBrowser__WCS417:GFF2997
MRTIDLAGVPVPVIGQGTWRMGENPDQHRAEVAALQLGIDEGMTLIDTAEMYGDGGAETV
VGEAIRGKRDQVFLVSKVYPHNASHKGVPRACEASLQRLGTDYIDLYLLHWRGQYPLEET
VEAFERLREAGKIGRWGVSNFDVADLQELASPACATNQVLYNIEERGIEFDLLPWWQQHH
LPLMAYCPIAQGGELLSSPTLKQIAHRHEVTPAQVSLAWVLRQDGVIAIPKAVTPEHVRL
NAAAAKLVLDEHDLEAIDRVFGAPKRKHPLAMV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory