Comparing GFF30 FitnessBrowser__Phaeo:GFF30 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
35% identity, 94% coverage: 15:322/326 of query aligns to 17:313/318 of Q9I6K2
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
35% identity, 94% coverage: 15:322/326 of query aligns to 14:310/315 of 3niqA
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
35% identity, 94% coverage: 15:322/326 of query aligns to 15:311/316 of 3nipB
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
29% identity, 94% coverage: 15:319/326 of query aligns to 17:313/319 of Q9I3S3
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
29% identity, 94% coverage: 15:319/326 of query aligns to 14:310/316 of 3nioA
7lbaB E. Coli agmatinase (see paper)
31% identity, 90% coverage: 7:298/326 of query aligns to 17:287/310 of 7lbaB
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
31% identity, 90% coverage: 7:298/326 of query aligns to 10:280/306 of P60651
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
33% identity, 82% coverage: 33:299/326 of query aligns to 20:261/284 of 7loxA
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
32% identity, 82% coverage: 33:298/326 of query aligns to 24:270/294 of 7lolA
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
30% identity, 96% coverage: 15:326/326 of query aligns to 12:312/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
30% identity, 95% coverage: 15:323/326 of query aligns to 4:301/301 of 1gq6B
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
29% identity, 83% coverage: 47:318/326 of query aligns to 60:314/323 of 4dz4B
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
31% identity, 73% coverage: 83:321/326 of query aligns to 90:318/318 of 6vsuE
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 73% coverage: 83:321/326 of query aligns to 114:342/342 of P46637
Sites not aligning to the query:
G7JFU5 Arginase, mitochondrial; Agmatinase ARGAH; Arginine amidohydrolase; MtARGAH; EC 3.5.3.1; EC 3.5.3.11 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
32% identity, 73% coverage: 83:321/326 of query aligns to 110:338/338 of G7JFU5
Sites not aligning to the query:
6vstA Arginase from medicago truncatula in complex with ornithine (see paper)
32% identity, 73% coverage: 83:321/326 of query aligns to 89:317/317 of 6vstA
6vstD Arginase from medicago truncatula in complex with ornithine (see paper)
32% identity, 73% coverage: 83:321/326 of query aligns to 92:320/320 of 6vstD
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
26% identity, 96% coverage: 14:326/326 of query aligns to 53:362/378 of 7esrA
2ef5A Crystal structure of the arginase from thermus thermophilus
29% identity, 70% coverage: 32:260/326 of query aligns to 1:214/273 of 2ef5A
Sites not aligning to the query:
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
27% identity, 92% coverage: 12:312/326 of query aligns to 4:292/303 of 1wogA
>GFF30 FitnessBrowser__Phaeo:GFF30
MSDPHLNAMMENLYWWGIPTLFRCPNLPVDGQDIALVGVPHSAGNGTTERDQHLGPRALR
NVSSVQRRMHSGFQLDPWNAAKIVDLGDVPFPKANDNEDCIQQITNFYQQIDKAGARPVS
VGGDHSITGGIVQALGCGAITKGEPICFLHLDAHTDVFTKVDHFLGAKKSAAHWGAYLAD
QGKVDPAHSMQIGIRGHARTLDWLQPSYEYGYNVVTMKDYRRRGLADVVAQVTEVLAGRP
VYITFDLDCLDPTIAPGVSNIEAGEKGFGIDDAVGLLHAVRGMNIVGGDVVCMMPTKDSP
NQITALTAGAIMFEIISMIAENHLSQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory