Comparing GFF3013 FitnessBrowser__Marino:GFF3013 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
29% identity, 86% coverage: 23:286/308 of query aligns to 6:264/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
25% identity, 71% coverage: 64:281/308 of query aligns to 68:286/313 of P94529
>GFF3013 FitnessBrowser__Marino:GFF3013
MEHIQRQPARVARAPSRFLDALQRWLPKLVVAPTFVLIGVGIYGYMLWTGVLSFTSSSFL
PVYDFVGFDQYAKLMANDRWLTASINLGIFGGLFVLSCLVIGVILAIFLDQRIRQEGAIR
TIYLYPMALSMIVTGTVWKWILNPSLGLEKLMHDWGWTSFSFDWLVSSDMAIYTIVMAAV
WQASGFVMALFLAGLRGVDSSIIRAARVDGASLPLIYWKIILPSLRPVFFSAVMVLAHIA
IKSFDLVMAMTAGGPGYSTDLPAVFMYAHTFTRGQMGLGSASAMLMLGAILALIVPYLYS
ELREKRHD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory