Comparing GFF3050 FitnessBrowser__psRCH2:GFF3050 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3i09A Crystal structure of a periplasmic binding protein (bma2936) from burkholderia mallei at 1.80 a resolution
24% identity, 92% coverage: 20:399/414 of query aligns to 2:368/375 of 3i09A
3i45A Crystal structure of putative twin-arginine translocation pathway signal protein from rhodospirillum rubrum atcc 11170
25% identity, 80% coverage: 40:370/414 of query aligns to 21:348/378 of 3i45A
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
28% identity, 50% coverage: 23:227/414 of query aligns to 3:200/345 of 4n0qB
Sites not aligning to the query:
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
25% identity, 82% coverage: 23:362/414 of query aligns to 3:331/348 of 4gnrA
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
24% identity, 79% coverage: 23:347/414 of query aligns to 3:316/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
24% identity, 79% coverage: 23:347/414 of query aligns to 3:316/348 of 3ip7A
Sites not aligning to the query:
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
24% identity, 79% coverage: 23:347/414 of query aligns to 3:316/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
24% identity, 79% coverage: 23:347/414 of query aligns to 3:316/348 of 3ip5A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
24% identity, 79% coverage: 23:347/414 of query aligns to 3:316/348 of 3ipcA
8hicA Crystal structure of urta from prochlorococcus marinus str. Mit 9313 in complex with urea and calcium
22% identity, 76% coverage: 21:336/414 of query aligns to 3:320/395 of 8hicA
Sites not aligning to the query:
1qo0B Amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir. (see paper)
24% identity, 61% coverage: 25:275/414 of query aligns to 4:250/374 of 1qo0B
1peaA Amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with acetamide (see paper)
24% identity, 61% coverage: 25:275/414 of query aligns to 3:249/368 of 1peaA
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
30% identity, 30% coverage: 44:168/414 of query aligns to 20:144/335 of 4q6bA
Sites not aligning to the query:
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
30% identity, 30% coverage: 44:168/414 of query aligns to 20:144/336 of 4mlcA
Sites not aligning to the query:
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
21% identity, 89% coverage: 20:387/414 of query aligns to 1:366/376 of 4q6wA
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
25% identity, 26% coverage: 32:137/414 of query aligns to 12:116/344 of 1z18A
Sites not aligning to the query:
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
25% identity, 26% coverage: 32:137/414 of query aligns to 12:116/344 of 1z17A
Sites not aligning to the query:
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
25% identity, 26% coverage: 32:137/414 of query aligns to 12:116/344 of 1z16A
Sites not aligning to the query:
1uskA L-leucine-binding protein with leucine bound (see paper)
25% identity, 28% coverage: 21:137/414 of query aligns to 1:116/345 of 1uskA
Sites not aligning to the query:
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
25% identity, 28% coverage: 21:137/414 of query aligns to 1:116/345 of 1usiA
Sites not aligning to the query:
>GFF3050 FitnessBrowser__psRCH2:GFF3050
MNRITLLALGLGFCLTAQAADPITLGLNYPRTGSYKEEGLAQMRGALMAIDEINQAGGVL
GRPLQLISRNTASRPDKAIANVDKMADEGVAMLFGGVSSAVAIAASKRAKERGLLYFGTL
TYSNDTTGKDGHRYMFRECNNAWMSARVLGQYLNENMPGKTYFYITSDYTWGHTSESSLR
QATGTVDQNRHQGVKTAFPGARLSDYRAALEKASNSGAEVLVLVLFGEDMVRAMRIADEL
GLNKKMQIAIPNLTLSMVELAGPDIMRGVLGTEPWTWRVPELEGSERGKAFVRNFGDRYQ
THPSSSAASAYSIVYQWADAATRAKSIGSEQVISALENHSYSLLKGQQQWRGFDHQNVQT
VYAVRVKPREEVLKDRFKQDYFEIVHRLSGEQAAPTLAEWQEERRAGGQPTRLQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory