SitesBLAST
Comparing GFF3145 FitnessBrowser__psRCH2:GFF3145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bt9C Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with NADP (see paper)
29% identity, 98% coverage: 4:233/234 of query aligns to 8:242/250 of 5bt9C
- active site: R18 (= R14), I140 (= I131), Y155 (= Y146), K159 (= K150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R18 (= R14), I19 (= I15), C38 (≠ Y34), N39 (≠ R35), R40 (= R36), S41 (≠ E37), L66 (≠ F56), E67 (= E59), N90 (= N82), S92 (= S84), I140 (= I131), K159 (= K150), P184 (= P175), G185 (≠ A176), T187 (≠ I178), L188 (≠ Q179)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
30% identity, 97% coverage: 6:231/234 of query aligns to 7:250/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), S13 (= S12), R14 (≠ Q13), G15 (≠ R14), I16 (= I15), L36 (≠ R35), R37 (= R36), N38 (≠ E37), A61 (= A54), D62 (= D55), V63 (≠ F56), N89 (= N82), A90 (= A83), G91 (≠ S84), T113 (≠ V104), V143 (≠ I131), S145 (≠ D133), Y159 (= Y146), K163 (= K150), P189 (= P175), G190 (≠ A176), I192 (= I178), T194 (vs. gap), I196 (≠ F180), H197 (≠ N181)
1p33B Pteridine reductase from leishmania tarentolae complex with NADPH and mtx (see paper)
29% identity, 98% coverage: 4:233/234 of query aligns to 4:266/269 of 1p33B
- active site: R15 (= R14), D162 (= D133), Y175 (= Y146)
- binding methotrexate: R15 (= R14), S103 (= S84), F105 (≠ W86), Y172 (≠ H143), Y175 (= Y146), L207 (= L177), P211 (= P182), M214 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R15 (= R14), L16 (≠ I15), H36 (≠ R35), R37 (= R36), S38 (≠ E37), D63 (= D55), L64 (≠ F56), N101 (= N82), A102 (= A83), S103 (= S84), S104 (≠ E85), M160 (≠ I131), V161 (≠ G132), K179 (= K150), G206 (≠ A176), S208 (≠ I178), V209 (≠ Q179)
4cm7A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:250/252 of 4cm7A
- active site: R13 (= R14), D145 (= D133), Y158 (= Y146), K162 (= K150)
- binding 5-phenethyl-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine: S94 (= S84), F96 (≠ W86), Y158 (= Y146), G189 (≠ A176), W205 (≠ Y188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), D61 (= D55), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T118 (≠ V104), L143 (≠ I131), K162 (= K150), P188 (= P175), S191 (vs. gap), L192 (vs. gap)
1mxhA Crystal structure of substrate complex of putative pteridine reductase 2 (ptr2) from trypanosoma cruzi (see paper)
33% identity, 96% coverage: 7:230/234 of query aligns to 5:242/248 of 1mxhA
- active site: R12 (= R14), D141 (= D133), Y154 (= Y146), K158 (= K150)
- binding dihydrofolic acid: S93 (= S84), Y95 (≠ W86), D141 (= D133), F151 (≠ H143), Y154 (= Y146), P190 (≠ N181), Y201 (= Y188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R12 (= R14), I13 (= I15), Y32 (= Y34), R33 (= R35), H34 (≠ R36), S35 (≠ E37), L61 (≠ F56), N91 (= N82), A92 (= A83), S93 (= S84), E110 (≠ Q100), L139 (≠ I131), C140 (≠ G132), K158 (= K150), P184 (= P175), G185 (≠ A176), S187 (≠ I178), L188 (≠ Q179)
4clhA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:250/252 of 4clhA
- active site: R13 (= R14), D145 (= D133), Y158 (= Y146), K162 (= K150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), H32 (≠ T33), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), D61 (= D55), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T117 (≠ V104), L143 (≠ I131), K162 (= K150), P188 (= P175), G189 (≠ A176), S191 (vs. gap)
- binding 4-thiomorpholino-7H-pyrrolo[2,3-d]pyrimidin-2-amine: S94 (= S84), F96 (≠ W86), F96 (≠ W86), D145 (= D133), C152 (≠ S140), F155 (≠ H143), Y158 (= Y146), P194 (vs. gap), W205 (≠ Y188)
4cleA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:250/252 of 4cleA
- active site: R13 (= R14), D145 (= D133), Y158 (= Y146), K162 (= K150)
- binding 4-(pyrrolidin-1-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine: S94 (= S84), F96 (≠ W86), F96 (≠ W86), D145 (= D133), C152 (≠ S140), Y158 (= Y146), G189 (≠ A176), P194 (vs. gap), W205 (≠ Y188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T117 (≠ V104), K162 (= K150), P188 (= P175), S191 (vs. gap)
2c7vC Structure of trypanosoma brucei pteridine reductase (ptr1) in ternary complex with cofactor and the antifolate methotrexate (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:258/260 of 2c7vC
- active site: R13 (= R14), D153 (= D133), Y166 (= Y146), K170 (= K150)
- binding methotrexate: R13 (= R14), S94 (= S84), F96 (≠ W86), P98 (= P88), Y166 (= Y146), P202 (vs. gap), M205 (≠ F180), W213 (≠ Y188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), H32 (≠ T33), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), D61 (= D55), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T118 (≠ V104), L151 (≠ I131), C152 (≠ G132), K170 (= K150), P196 (= P175), S199 (vs. gap)
3bmoA Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor (compound ax4) (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:253/255 of 3bmoA
- active site: R13 (= R14), D148 (= D133), Y161 (= Y146), K165 (= K150)
- binding 6-[(4-methylphenyl)sulfanyl]pyrimidine-2,4-diamine: S94 (= S84), F96 (≠ W86), Y161 (= Y146), L196 (vs. gap), P197 (vs. gap), W208 (≠ Y188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), D61 (= D55), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T117 (≠ V104), L146 (≠ I131), K165 (= K150), P191 (= P175), G192 (≠ A176), V193 (≠ L177), S194 (vs. gap)
7opjA Trypanosoma brucei ptr1 (tbptr1) in complex with pyrimethamine (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:248/250 of 7opjA
- binding 5-(4-chloro-phenyl)-6-ethyl-pyrimidine-2,4-diamine: S94 (= S84), F96 (≠ W86), Y156 (= Y146), P192 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), H32 (≠ T33), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T117 (≠ V104), L141 (≠ I131), D143 (= D133), K160 (= K150), P186 (= P175), G187 (≠ A176), V188 (≠ L177), S189 (vs. gap), L190 (vs. gap)
6gd4A Trypanosoma brucei ptr1 in complex with inhibitor 4c (f188) (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:248/250 of 6gd4A
- active site: R13 (= R14), D143 (= D133), Y156 (= Y146), K160 (= K150)
- binding 2-amino-1,3-benzothiazole-6-carboxamide: S94 (= S84), F96 (≠ W86), D143 (= D133), Y156 (= Y146)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), L62 (≠ F56), N92 (= N82), S94 (= S84), T117 (≠ V104), L141 (≠ I131), K160 (= K150), P186 (= P175), G187 (≠ A176), S189 (vs. gap)
6gclA Trypanosoma brucei ptr1 in complex with inhibitor 3a (f020) (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:248/250 of 6gclA
- active site: R13 (= R14), D143 (= D133), Y156 (= Y146), K160 (= K150)
- binding 6-methylsulfonyl-1,3-benzothiazol-2-amine: S94 (= S84), F96 (≠ W86), Y156 (= Y146), P192 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), L62 (≠ F56), N92 (= N82), S94 (= S84), T117 (≠ V104), L141 (≠ I131), K160 (= K150), P186 (= P175), G187 (≠ A176), S189 (vs. gap), L190 (vs. gap)
4wcdA Trypanosoma brucei ptr1 in complex with inhibitor 10 (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:248/250 of 4wcdA
- active site: R13 (= R14), D143 (= D133), Y156 (= Y146), K160 (= K150)
- binding 5-(1H-benzotriazol-6-yl)-1,3,4-thiadiazol-2-amine: F96 (≠ W86), V188 (≠ L177), P192 (vs. gap), W203 (≠ Y188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), D61 (= D55), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T117 (≠ V104), L141 (≠ I131), K160 (= K150), P186 (= P175), G187 (≠ A176), S189 (vs. gap), L190 (vs. gap)
4cmkA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:248/250 of 4cmkA
- active site: R13 (= R14), D143 (= D133), Y156 (= Y146), K160 (= K150)
- binding 2-amino-5-phenethyl-6-phenyl-3H-pyrrolo[2,3-d]pyrimidin-4(7H)-one: S94 (= S84), F96 (≠ W86), D143 (= D133), M145 (≠ V135), C150 (≠ S140), F153 (≠ H143), Y156 (= Y146), G187 (≠ A176), V188 (≠ L177), P192 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), D61 (= D55), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T117 (≠ V104), L141 (≠ I131), K160 (= K150), P186 (= P175), G187 (≠ A176), V188 (≠ L177), S189 (vs. gap)
4cm8A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:248/250 of 4cm8A
- active site: R13 (= R14), D143 (= D133), Y156 (= Y146), K160 (= K150)
- binding (E)-2,4-diamino-6-(4-methylstyryl)-7H-pyrrolo[2,3-d]pyrimidine-5-carbonitrile: S94 (= S84), F96 (≠ W86), D143 (= D133), M145 (≠ V135), C150 (≠ S140), Y156 (= Y146), W203 (≠ Y188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), D61 (= D55), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T117 (≠ V104), L141 (≠ I131), K160 (= K150), P186 (= P175), G187 (≠ A176), S189 (vs. gap), L190 (vs. gap)
4clrA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:248/250 of 4clrA
- active site: R13 (= R14), D143 (= D133), Y156 (= Y146), K160 (= K150)
- binding 2-amino-5-methyl-3H-pyrrolo[2,3-d]pyrimidin-4(7H)-one: S94 (= S84), F96 (≠ W86), Y156 (= Y146), P192 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), D61 (= D55), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T117 (≠ V104), L141 (≠ I131), K160 (= K150), P186 (= P175), G187 (≠ A176), V188 (≠ L177), S189 (vs. gap), L190 (vs. gap)
2x9vA High resolution structure of tbptr1 with trimetrexate (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:248/250 of 2x9vA
- active site: R13 (= R14), D143 (= D133), Y156 (= Y146), K160 (= K150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T117 (≠ V104), L141 (≠ I131), K160 (= K150), P186 (= P175), G187 (≠ A176), V188 (≠ L177), S189 (vs. gap)
- binding trimetrexate: S94 (= S84), F96 (≠ W86), Y156 (= Y146), P192 (vs. gap), M195 (≠ F180)
6gd0A Trypanosoma brucei ptr1 in complex with inhibitor 4g (f133) (see paper)
27% identity, 97% coverage: 7:234/234 of query aligns to 6:252/254 of 6gd0A
- active site: R13 (= R14), D147 (= D133), Y160 (= Y146), K164 (= K150)
- binding methyl 1-[4-[[(2-azanyl-1,3-benzothiazol-6-yl)carbonylamino]methyl]phenyl]carbonylpiperidine-4-carboxylate: S94 (= S84), F96 (≠ W86), C154 (≠ S140), Y160 (= Y146), A198 (≠ Q179), M199 (≠ F180), W207 (≠ Y188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), L62 (≠ F56), N92 (= N82), S94 (= S84), T117 (≠ V104), L145 (≠ I131), K164 (= K150), P190 (= P175), G191 (≠ A176), V192 (≠ L177), S193 (vs. gap), L194 (vs. gap)
6rx6A Trypanosoma brucei ptr1 (tbptr1) in complex with inhibitor 4 (nmt- c0026) (see paper)
26% identity, 97% coverage: 7:234/234 of query aligns to 6:246/248 of 6rx6A
- active site: R13 (= R14), D141 (= D133), Y154 (= Y146), K158 (= K150)
- binding methyl 1-[4-[[2,4-bis(azanyl)pteridin-6-yl]methyl-(3-oxidanylpropyl)amino]phenyl]carbonylpiperidine-4-carboxylate: R13 (= R14), S94 (= S84), F96 (≠ W86), Y154 (= Y146), P190 (vs. gap), M193 (≠ F180), W201 (≠ Y188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T115 (≠ V104), L139 (≠ I131), K158 (= K150), P184 (= P175), G185 (≠ A176), S187 (vs. gap)
6rx0A Trypanosoma brucei ptr1 (tbptr1) in complex with inhibitor 3 (nmt- c0013) (see paper)
26% identity, 97% coverage: 7:234/234 of query aligns to 6:246/248 of 6rx0A
- active site: R13 (= R14), D141 (= D133), Y154 (= Y146), K158 (= K150)
- binding methyl 1-[4-[[2,4-bis(azanyl)pteridin-6-yl]methyl-ethyl-amino]phenyl]carbonylpiperidine-4-carboxylate: R13 (= R14), S94 (= S84), F96 (≠ W86), P98 (= P88), F151 (≠ H143), Y154 (= Y146), P190 (vs. gap), M193 (≠ F180), W201 (≠ Y188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R14), I14 (= I15), Y33 (= Y34), H34 (≠ R35), N35 (≠ R36), S36 (≠ E37), L62 (≠ F56), N92 (= N82), A93 (= A83), S94 (= S84), T115 (≠ V104), L139 (≠ I131), K158 (= K150), P184 (= P175), S187 (vs. gap)
Query Sequence
>GFF3145 FitnessBrowser__psRCH2:GFF3145
MHQAPILITGASQRIGLHCAERLLEDGFTVIVTYRRERDSIDRLRTLGASTLKADFSDEA
GITGFIAALREQTASLRAIVHNASEWRPDTPGQEAEAFRQLFQVHMLAPYLINLHCADLL
RHGGPADIVHIGDDVTRKGSKKHIAYAASKAGLDNLTLSFAASLAPAIKVNGIAPALIQF
NPDDDEEYRRKALAKSALGIEPGAEVIYQSLRYLLDNPYVTGTTLTVNGGRHLI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory