Comparing GFF3215 FitnessBrowser__Phaeo:GFF3215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4gf0A Crystal structure of glutahtione transferase homolog from sulfitobacter, target efi-501084, with bound glutathione
63% identity, 100% coverage: 1:205/205 of query aligns to 3:208/208 of 4gf0A
2gdrA Crystal structure of a bacterial glutathione transferase (see paper)
32% identity, 100% coverage: 2:205/205 of query aligns to 1:201/202 of 2gdrA
2dsaA Ternary complex of bphk, a bacterial gst (see paper)
32% identity, 99% coverage: 2:204/205 of query aligns to 1:200/200 of 2dsaA
3uarA Crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. Bath with gsh bound
33% identity, 100% coverage: 1:205/205 of query aligns to 1:203/203 of 3uarA
1pmtA Glutathione transferase from proteus mirabilis (see paper)
31% identity, 100% coverage: 2:205/205 of query aligns to 1:201/201 of 1pmtA
P15214 Glutathione S-transferase GST-6.0; GST B1-1; EC 2.5.1.18 from Proteus mirabilis (see paper)
31% identity, 100% coverage: 2:205/205 of query aligns to 1:201/203 of P15214
4g9hA Crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione
30% identity, 98% coverage: 1:201/205 of query aligns to 2:198/202 of 4g9hA
1f2eA Structure of sphingomonad, glutathione s-transferase complexed with glutathione
32% identity, 99% coverage: 2:204/205 of query aligns to 1:200/201 of 1f2eA
6m1tA Bacterial beta class sphingomonas chungbukensis glutathione s- transferase
32% identity, 100% coverage: 2:205/205 of query aligns to 1:201/201 of 6m1tA
4kgiC Crystal structure of a glutathione transferase family member from shigella flexneri, target efi-507258, bound gsh, tev-his-tag linker in active site
28% identity, 99% coverage: 2:204/205 of query aligns to 7:206/206 of 4kgiC
1a0fA Crystal structure of glutathione s-transferase from escherichia coli complexed with glutathionesulfonic acid (see paper)
28% identity, 99% coverage: 2:204/205 of query aligns to 1:200/201 of 1a0fA
P0A9D2 Glutathione S-transferase GstA; GST B1-1; EC 2.5.1.18 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 99% coverage: 2:204/205 of query aligns to 1:200/201 of P0A9D2
4xt0A Crystal structure of beta-etherase ligf from sphingobium sp. Strain syk-6 (see paper)
41% identity, 45% coverage: 2:93/205 of query aligns to 3:97/243 of 4xt0A
Sites not aligning to the query:
2ntoA Structure of the glutathione transferase from ochrobactrum anthropi in complex with glutathione (see paper)
29% identity, 99% coverage: 2:204/205 of query aligns to 1:200/201 of 2ntoA
P81065 Glutathione S-transferase; EC 2.5.1.18 from Brucella anthropi (Ochrobactrum anthropi) (see 2 papers)
29% identity, 99% coverage: 2:204/205 of query aligns to 1:200/201 of P81065
4mf6A Crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with two glutathione molecules bound per one protein subunit
27% identity, 95% coverage: 2:196/205 of query aligns to 27:230/240 of 4mf6A
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
29% identity, 87% coverage: 6:183/205 of query aligns to 11:186/216 of Q9WVL0
4nhzH Crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., Target efi-507290, with one glutathione bound
32% identity, 58% coverage: 2:120/205 of query aligns to 33:160/246 of 4nhzH
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
29% identity, 87% coverage: 6:183/205 of query aligns to 8:183/212 of 2cz2A
4ivfF Crystal structure of glutathione transferase homolog from lodderomyces elongisporus, target efi-501753, with two gsh per subunit
40% identity, 36% coverage: 2:75/205 of query aligns to 4:84/227 of 4ivfF
Sites not aligning to the query:
>GFF3215 FitnessBrowser__Phaeo:GFF3215
MMQLYYAPKTISVAVAIALEEAGLDYEPIRIDFAAKEQLGDAYAQINPKGRVPALVVDGG
ILTETGALLEYVADVAPDAGLRPTDPVLLARMREVMFYLASTMHVNHAHKLRGSRWATER
SSWKDMQKMVPQTMAASCDYICQSGLRGPLVLGDALSLADCYLYVVCSWLEGDGVDVADY
PKIQKFMASMDQRESIRAVTAKGML
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory