SitesBLAST
Comparing GFF3304 FitnessBrowser__psRCH2:GFF3304 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
32% identity, 94% coverage: 4:349/369 of query aligns to 3:347/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ V8), G8 (= G9), G10 (= G11), V11 (= V12), I12 (= I13), V30 (≠ L31), E31 (= E32), K32 (≠ S33), E38 (= E39), A39 (= A40), S40 (= S41), A43 (≠ G44), G45 (= G46), L46 (≠ I47), V171 (= V173), G200 (≠ A202), G201 (= G203), W203 (= W205), G298 (= G300), R300 (= R302), P301 (= P303), Y326 (≠ F328), R327 (= R329), N328 (= N330), G329 (= G331), I330 (≠ L332)
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
31% identity, 90% coverage: 19:349/369 of query aligns to 21:349/364 of 3if9A
- active site: A47 (≠ G45), G48 (= G46), M49 (≠ I47)
- binding flavin-adenine dinucleotide: E34 (= E32), S35 (= S33), T42 (≠ A40), T43 (≠ S41), A46 (≠ G44), A47 (≠ G45), G48 (= G46), M49 (≠ I47), P173 (= P172), V174 (= V173), S202 (≠ A202), G203 (= G203), W205 (= W205), F209 (≠ L209), G300 (= G300), R302 (= R302), H327 (= H327), F328 (= F328), R329 (= R329), N330 (= N330), G331 (= G331), I332 (≠ L332)
- binding glycolic acid: Y246 (= Y246), R302 (= R302), R329 (= R329)
Sites not aligning to the query:
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
30% identity, 90% coverage: 19:349/369 of query aligns to 21:349/369 of O31616
- ES 34:35 (= ES 32:33) binding
- TT 42:43 (≠ AS 40:41) binding
- AGM 47:49 (≠ GGI 45:47) binding
- G51 (≠ S49) mutation to R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; mutation to S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- A54 (≠ Y52) mutation to R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- V174 (= V173) binding
- H244 (≠ R244) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R302) binding
- 327:333 (vs. 327:333, 71% identical) binding
- R329 (= R329) binding
Sites not aligning to the query:
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
30% identity, 90% coverage: 19:349/369 of query aligns to 21:349/364 of 1ng3A
- active site: A47 (≠ G45), G48 (= G46), M49 (≠ I47)
- binding acetylamino-acetic acid: Y246 (= Y246), R302 (= R302), R329 (= R329)
- binding flavin-adenine dinucleotide: F33 (≠ L31), E34 (= E32), S35 (= S33), R41 (≠ E39), T42 (≠ A40), T43 (≠ S41), A46 (≠ G44), A47 (≠ G45), G48 (= G46), M49 (≠ I47), V174 (= V173), S202 (≠ A202), G203 (= G203), W205 (= W205), F209 (≠ L209), G300 (= G300), R302 (= R302), H327 (= H327), R329 (= R329), N330 (= N330), G331 (= G331), I332 (≠ L332)
- binding phosphate ion: R89 (≠ E87), R254 (≠ H254)
Sites not aligning to the query:
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
30% identity, 90% coverage: 18:349/369 of query aligns to 20:349/369 of S5FMM4
- G51 (≠ S49) mutation to S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- A54 (≠ Y52) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- K81 (≠ L79) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ A202) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ L332) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L342) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
29% identity, 92% coverage: 19:359/369 of query aligns to 20:364/370 of 4yshA
- active site: A45 (≠ G44), M48 (≠ I47), L49 (≠ V48), Q52 (≠ L51), I262 (≠ V257), L283 (= L278), G305 (= G300), N335 (= N330), L338 (≠ V333)
- binding flavin-adenine dinucleotide: F32 (≠ L31), E33 (= E32), K34 (≠ S33), G40 (≠ E39), A41 (= A40), S42 (= S41), A45 (≠ G44), A46 (≠ G45), G47 (= G46), M48 (≠ I47), V178 (= V173), S206 (≠ A202), G207 (= G203), W209 (= W205), R307 (= R302), H332 (= H327), R334 (= R329), N335 (= N330), G336 (= G331), I337 (≠ L332)
Sites not aligning to the query:
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
29% identity, 92% coverage: 19:359/369 of query aligns to 20:364/368 of 4yshB
- active site: A45 (≠ G44), M48 (≠ I47), L49 (≠ V48), Q52 (≠ L51), I262 (≠ V257), L283 (= L278), G305 (= G300), N335 (= N330), L338 (≠ V333)
- binding flavin-adenine dinucleotide: F32 (≠ L31), E33 (= E32), K34 (≠ S33), G40 (≠ E39), A41 (= A40), S42 (= S41), A45 (≠ G44), A46 (≠ G45), M48 (≠ I47), V178 (= V173), S206 (≠ A202), W209 (= W205), R307 (= R302), H332 (= H327), R334 (= R329), N335 (= N330), G336 (= G331), I337 (≠ L332), L338 (≠ V333)
- binding glycine: G249 (≠ R245), Y251 (= Y246), Y251 (= Y246), A264 (≠ S259), R307 (= R302), R334 (= R329), R334 (= R329)
Sites not aligning to the query:
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
29% identity, 92% coverage: 19:359/369 of query aligns to 21:366/377 of Q5L2C2
- EK 34:35 (≠ ES 32:33) binding
- AS 42:43 (= AS 40:41) binding
- AGM 47:49 (≠ GGI 45:47) binding
- V180 (= V173) binding
- R309 (= R302) binding
- 334:340 (vs. 327:333, 57% identical) binding
- R336 (= R329) binding
Sites not aligning to the query:
6j39A Crystal structure of cmis2 with inhibitor (see paper)
29% identity, 92% coverage: 13:353/369 of query aligns to 11:359/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: M44 (≠ I47), P46 (≠ S49), N49 (≠ Y52), R243 (≠ L241), Y252 (= Y246), Y267 (≠ L261), R308 (= R302), R334 (= R329), I335 (≠ N330)
- binding flavin-adenine dinucleotide: I11 (= I13), V29 (≠ L31), D30 (≠ E32), P31 (≠ S33), E32 (≠ A35), K36 (≠ E39), A37 (= A40), S38 (= S41), V40 (≠ A43), S41 (≠ G44), A42 (≠ G45), G43 (= G46), M44 (≠ I47), A174 (≠ P172), A203 (= A202), W206 (= W205), I228 (≠ M226), Y252 (= Y246), R308 (= R302), S333 (≠ F328), R334 (= R329), I335 (≠ N330), G336 (= G331), V337 (≠ L332), Q338 (≠ V333)
Sites not aligning to the query:
6j38A Crystal structure of cmis2 (see paper)
29% identity, 92% coverage: 13:353/369 of query aligns to 11:359/368 of 6j38A
- binding flavin-adenine dinucleotide: I11 (= I13), V29 (≠ L31), D30 (≠ E32), P31 (≠ S33), K36 (≠ E39), A37 (= A40), S38 (= S41), S41 (≠ G44), A42 (≠ G45), G43 (= G46), M44 (≠ I47), A174 (≠ P172), A203 (= A202), W206 (= W205), G226 (= G224), G306 (= G300), R308 (= R302), S333 (≠ F328), R334 (= R329), I335 (≠ N330), G336 (= G331), V337 (≠ L332), Q338 (≠ V333)
Sites not aligning to the query:
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
30% identity, 97% coverage: 4:362/369 of query aligns to 2:367/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G9), G9 (= G11), I10 (≠ V12), D30 (≠ E32), N32 (≠ G34), H33 (≠ A35), K36 (≠ E39), A37 (= A40), T38 (≠ S41), A40 (= A43), G41 (= G44), A42 (≠ G45), G43 (= G46), V44 (≠ I47), Y174 (≠ P172), A203 (= A202), W206 (= W205), I210 (≠ L209), Y250 (= Y246), G305 (= G300), R307 (= R302), G333 (≠ F328), A334 (≠ R329), S335 (≠ N330), G336 (= G331), L337 (= L332), T338 (≠ V333)
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
24% identity, 96% coverage: 4:359/369 of query aligns to 21:383/403 of 2gagB
- active site: A61 (vs. gap), T64 (vs. gap), T65 (vs. gap)
- binding flavin-adenine dinucleotide: G26 (= G9), G28 (= G11), G29 (≠ V12), H30 (≠ I13), E51 (= E32), K52 (≠ S33), G58 (= G46), N59 (vs. gap), M60 (vs. gap), R62 (vs. gap), N63 (vs. gap), T64 (vs. gap), I66 (= I47), V195 (= V173), G224 (≠ A202), A225 (≠ G203), H227 (≠ W205), L231 (= L209), L246 (≠ G224), G352 (≠ F328), T353 (≠ R329), G354 (≠ N330), G355 (= G331), F356 (≠ L332), K357 (≠ V333)
- binding flavin mononucleotide: A61 (vs. gap), R62 (vs. gap), H171 (≠ N148), V250 (≠ L228), E278 (≠ H254), R321 (≠ K296), W323 (= W298)
- binding 2-furoic acid: T64 (vs. gap), I66 (= I47), R68 (≠ S49), M263 (≠ L241), Y270 (= Y246), K357 (≠ V333)
- binding sulfite ion: K170 (≠ R147), K276 (≠ D252)
Sites not aligning to the query:
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
28% identity, 95% coverage: 5:356/369 of query aligns to 28:393/824 of Q8GAI3
- W66 (= W42) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ A43) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
23% identity, 96% coverage: 4:359/369 of query aligns to 26:379/383 of 5i39A
- active site: F66 (≠ A43), Q69 (≠ G46), A70 (≠ I47), Q248 (≠ K223), P267 (≠ A242)
- binding flavin-adenine dinucleotide: V30 (= V8), G31 (= G9), G33 (= G11), I34 (≠ V12), L35 (≠ I13), V53 (≠ L31), E54 (= E32), K55 (≠ S33), Q62 (≠ E39), S63 (≠ A40), F66 (≠ A43), Y67 (≠ G44), Q69 (≠ G46), A196 (≠ P172), A197 (≠ V173), G226 (≠ A202), G227 (= G203), W229 (= W205), Q248 (≠ K223), Q250 (= Q225), G321 (= G300), M323 (≠ R302), T348 (≠ H327), G349 (≠ F328), W350 (≠ R329), G351 (= G331), M352 (≠ L332), T353 (≠ V333)
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
24% identity, 85% coverage: 15:326/369 of query aligns to 34:352/405 of P40875
- C146 (≠ V127) mutation to S: No change in activity.
- H173 (≠ N148) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ R150) mutation to A: No effect on FMN binding and activity.
- C195 (= C171) mutation to S: No change in activity.
- C351 (= C325) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
27% identity, 53% coverage: 165:359/369 of query aligns to 188:384/404 of 3ad8B
- active site: G326 (= G300), K358 (≠ V333)
- binding flavin-adenine dinucleotide: V196 (= V173), G225 (≠ A202), A226 (≠ G203), H228 (≠ W205), L247 (≠ G224), G353 (≠ F328), T354 (≠ R329), G355 (≠ N330), G356 (= G331), F357 (≠ L332), K358 (≠ V333)
- binding flavin mononucleotide: V251 (≠ L228), E279 (≠ H254), R322 (≠ K296), W324 (= W298)
- binding pyrrole-2-carboxylate: M264 (≠ L241), Y271 (= Y246), T354 (≠ R329), K358 (≠ V333)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
27% identity, 53% coverage: 165:359/369 of query aligns to 188:384/404 of 3ad7B
- active site: G326 (= G300), K358 (≠ V333)
- binding flavin-adenine dinucleotide: V196 (= V173), G225 (≠ A202), A226 (≠ G203), H228 (≠ W205), L247 (≠ G224), G353 (≠ F328), T354 (≠ R329), G355 (≠ N330), G356 (= G331), F357 (≠ L332), K358 (≠ V333)
- binding flavin mononucleotide: V251 (≠ L228), K277 (≠ D252), E279 (≠ H254), R322 (≠ K296), W324 (= W298)
- binding [methylthio]acetate: M264 (≠ L241), Y271 (= Y246), T354 (≠ R329), K358 (≠ V333)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
- binding [methylthio]acetate: 67, 69, 402
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
27% identity, 53% coverage: 165:359/369 of query aligns to 189:385/405 of Q50LF2
- V197 (= V173) binding
- H270 (≠ R244) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (= Y246) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (≠ F328) binding
- G357 (= G331) binding
- K359 (≠ V333) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
- 172 K→A: Retains 39% of wild-type activity.; K→D: Retains 32% of wild-type activity.; K→R: Retains 58% of wild-type activity.
- 173 modified: Tele-8alpha-FMN histidine
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
27% identity, 53% coverage: 165:359/369 of query aligns to 188:384/402 of 1vrqB
- active site: G326 (= G300), K358 (≠ V333)
- binding n,n-dimethylglycine: K358 (≠ V333)
- binding flavin-adenine dinucleotide: V196 (= V173), A224 (= A201), G225 (≠ A202), H228 (≠ W205), L247 (≠ G224), G353 (≠ F328), T354 (≠ R329), G355 (≠ N330), G356 (= G331), F357 (≠ L332), K358 (≠ V333)
- binding flavin mononucleotide: V251 (≠ L228), E279 (≠ H254), R322 (≠ K296), W324 (= W298)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
22% identity, 89% coverage: 18:346/369 of query aligns to 20:351/374 of 1y56B
- active site: F44 (≠ W42), G47 (= G45), T48 (≠ G46), H224 (≠ G224), P239 (≠ M239), G305 (= G300), M338 (≠ V333)
- binding flavin-adenine dinucleotide: I33 (≠ L31), E34 (= E32), K35 (≠ S33), S42 (≠ A40), T43 (≠ S41), R45 (≠ A43), C46 (≠ G44), G47 (= G45), G49 (≠ I47), E170 (≠ P172), V171 (= V173), T200 (≠ A202), N201 (≠ G203), W203 (= W205), G305 (= G300), Y306 (≠ L301), Y307 (≠ R302), G334 (≠ R329), H335 (≠ N330), G336 (= G331), F337 (≠ L332), M338 (≠ V333)
- binding flavin mononucleotide: F44 (≠ W42), R45 (≠ A43), I260 (vs. gap), R301 (≠ K296), W303 (= W298)
Sites not aligning to the query:
Query Sequence
>GFF3304 FitnessBrowser__psRCH2:GFF3304
MNQEVIVVGGGVIGLLSAYRLAEAGKAVSLLESGAVGSEASWAGGGIVSPLYPWRYSPAV
TALAHWSQDFYPQLGERLLSETGVDPEVHVTGLYWLDLHDEAEALSWAERYGRPLTSVSM
ETVRQAVPSLGESYKRAVYMEGVANVRNPRLLRALREALRQLPNVNVIEQCPVKGFLRDG
TRIVGVQTAQGEMRADQVVVAAGAWSAQLLATLGLEIPVKPMKGQMILFKCAEDFLPSMV
LAKRRYAIPRRDGHILVGSTLEDVGFDKTPTEDALESLRATAIELLPALADAQVVKHWAG
LRPGSPDGVPYIGPVSGFDGLWLNCGHFRNGLVLAPASCQLLVDLMLGQAPIVDPSPYAP
AGRIADQKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory