SitesBLAST
Comparing GFF3437 FitnessBrowser__Phaeo:GFF3437 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
34% identity, 98% coverage: 1:401/408 of query aligns to 1:413/514 of P04968
- K62 (= K52) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N76) binding
- GGGGL 188:192 (≠ GGGGM 179:183) binding
- S315 (= S302) binding
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
34% identity, 93% coverage: 22:401/408 of query aligns to 28:409/494 of 1tdjA
- active site: K58 (= K52), A83 (= A74), E209 (= E201), S213 (≠ G205), C215 (= C207), G237 (= G229), L310 (≠ T301), S311 (= S302)
- binding pyridoxal-5'-phosphate: F57 (≠ Y51), K58 (= K52), N85 (= N76), G184 (= G179), G185 (= G180), G186 (= G181), G187 (= G182), G237 (= G229), E282 (= E275), S311 (= S302), G312 (= G303)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
33% identity, 72% coverage: 22:314/408 of query aligns to 26:321/326 of 2gn2A
- active site: K56 (= K52), A81 (= A74), Q207 (≠ E201), V211 (≠ G205), G213 (≠ C207), G235 (= G229), I308 (≠ T301), S309 (= S302)
- binding cytidine-5'-monophosphate: R51 (≠ P47), T52 (≠ V48), G53 (≠ R49), A114 (≠ K107), D117 (≠ M110), Y118 (≠ F111), N312 (= N305)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 74% coverage: 10:310/408 of query aligns to 15:316/323 of O59791
- S82 (≠ A74) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
27% identity, 74% coverage: 10:310/408 of query aligns to 10:311/318 of 1wtcA
- active site: K52 (= K52), S77 (≠ A74), E203 (= E201), G207 (= G205), D209 (≠ C207), G231 (= G229), I302 (≠ T301), S303 (= S302)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ P20), K47 (≠ P47), M48 (≠ V48), A109 (≠ Q106), A110 (≠ K107), Y114 (≠ F111)
- binding magnesium ion: E203 (= E201), G207 (= G205), D209 (≠ C207)
- binding pyridoxal-5'-phosphate: F51 (≠ Y51), K52 (= K52), N79 (= N76), G178 (vs. gap), G179 (≠ P177), G180 (≠ V178), G181 (= G179), G231 (= G229), E276 (= E275), T278 (≠ A277), S303 (= S302)
1v71A Crystal structure of s.Pombe serine racemase
27% identity, 74% coverage: 10:310/408 of query aligns to 10:311/318 of 1v71A
- active site: K52 (= K52), S77 (≠ A74), E203 (= E201), G207 (= G205), D209 (≠ C207), G231 (= G229), I302 (≠ T301), S303 (= S302)
- binding magnesium ion: E203 (= E201), G207 (= G205), D209 (≠ C207)
- binding pyridoxal-5'-phosphate: F51 (≠ Y51), K52 (= K52), N79 (= N76), G178 (vs. gap), G179 (≠ P177), G180 (≠ V178), G181 (= G179), G231 (= G229), E276 (= E275), T278 (≠ A277), S303 (= S302), G304 (= G303)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
27% identity, 74% coverage: 10:310/408 of query aligns to 11:312/319 of 2zr8A
- active site: K53 (= K52), S78 (≠ A74), E204 (= E201), G208 (= G205), D210 (≠ C207), G232 (= G229), I303 (≠ T301), S304 (= S302)
- binding magnesium ion: E204 (= E201), G208 (= G205), D210 (≠ C207)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (≠ Y51), K53 (= K52), S77 (= S73), S78 (≠ A74), N80 (= N76), H81 (= H77), P147 (= P146), G179 (vs. gap), G180 (≠ P177), G181 (≠ V178), G182 (= G179), G232 (= G229), E277 (= E275), T279 (≠ A277), S304 (= S302)
- binding serine: S78 (≠ A74), R129 (≠ T128), D231 (= D228), G232 (= G229), A233 (= A230), Q234 (≠ A231), T235 (≠ V232)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
27% identity, 74% coverage: 10:310/408 of query aligns to 11:312/319 of 2zpuA
- active site: K53 (= K52), S78 (≠ A74), E204 (= E201), G208 (= G205), D210 (≠ C207), G232 (= G229), I303 (≠ T301), S304 (= S302)
- binding magnesium ion: E204 (= E201), G208 (= G205), D210 (≠ C207)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (≠ Y51), K53 (= K52), S77 (= S73), S78 (≠ A74), N80 (= N76), H81 (= H77), P147 (= P146), G179 (vs. gap), G180 (≠ P177), G181 (≠ V178), G182 (= G179), G232 (= G229), E277 (= E275), T279 (≠ A277), S304 (= S302)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
29% identity, 76% coverage: 1:310/408 of query aligns to 3:312/319 of A4F2N8
- K53 (= K52) mutation to A: Loss of enzymatic activity.
1pwhA Rat liver l-serine dehydratase- complex with pyridoxyl-(o-methyl- serine)-5-monophosphate (see paper)
26% identity, 75% coverage: 14:317/408 of query aligns to 3:319/327 of 1pwhA
- active site: K41 (= K52), A65 (= A74), E194 (= E201), A198 (≠ G205), S200 (≠ C207), A222 (≠ G229), A269 (= A277), C303 (≠ T301)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-o-methyl-l-serine: F40 (≠ Y51), K41 (= K52), S64 (= S73), A65 (= A74), N67 (= N76), A68 (≠ H77), F136 (= F147), G168 (≠ I175), G169 (≠ L176), G170 (≠ P177), G171 (≠ V178), A222 (≠ G229), G224 (≠ A231), C303 (≠ T301), G304 (≠ S302)
Q8VBT2 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Mus musculus (Mouse)
27% identity, 67% coverage: 14:285/408 of query aligns to 3:277/327 of Q8VBT2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
6zspAAA serine racemase bound to atp and malonate. (see paper)
28% identity, 70% coverage: 22:308/408 of query aligns to 23:309/320 of 6zspAAA
- active site: K53 (= K52), S74 (≠ A74), E200 (= E201), A204 (≠ G205), D206 (≠ A206), G229 (= G229), L302 (≠ T301), S303 (= S302)
- binding adenosine-5'-triphosphate: S28 (= S27), S29 (≠ A28), I30 (≠ L29), K48 (≠ P47), T49 (≠ V48), Q79 (= Q79), Y111 (≠ F111), E266 (≠ L267), R267 (≠ N268), K269 (≠ E270), N306 (= N305)
- binding magnesium ion: E200 (= E201), A204 (≠ G205), D206 (≠ A206)
- binding malonate ion: K53 (= K52), S73 (= S73), S74 (≠ A74), N76 (= N76), H77 (= H77), R125 (≠ F125), G229 (= G229), S232 (≠ G233)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
27% identity, 70% coverage: 22:308/408 of query aligns to 23:316/320 of 7nbhAAA
- active site: K53 (= K52), S81 (≠ A74), E207 (= E201), A211 (≠ G205), D213 (≠ A206), G236 (= G229), L309 (≠ T301), S310 (= S302)
- binding calcium ion: E207 (= E201), A211 (≠ G205), D213 (≠ A206)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A74), G85 (≠ A78), Q86 (= Q79), K111 (= K104), I115 (≠ T108), Y118 (≠ F111), D235 (= D228), P281 (= P276), N313 (= N305), V314 (≠ F306), D315 (= D307)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
27% identity, 70% coverage: 22:308/408 of query aligns to 24:312/322 of 3l6bA
- active site: K54 (= K52), S77 (≠ A74), E203 (= E201), A207 (≠ G205), D209 (≠ A206), G232 (= G229), T278 (≠ A277), L305 (≠ T301), S306 (= S302)
- binding malonate ion: K54 (= K52), S76 (= S73), S77 (≠ A74), N79 (= N76), H80 (= H77), R128 (≠ F125), G232 (= G229)
- binding manganese (ii) ion: E203 (= E201), A207 (≠ G205), D209 (≠ A206)
- binding pyridoxal-5'-phosphate: F53 (≠ Y51), K54 (= K52), N79 (= N76), G178 (= G179), G179 (= G180), G180 (= G181), G181 (= G182), M182 (= M183), V233 (≠ A230), E276 (= E275), T278 (≠ A277), S306 (= S302), G307 (= G303)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
27% identity, 70% coverage: 22:308/408 of query aligns to 23:316/323 of 7nbfAAA
- active site: K53 (= K52), S81 (≠ A74), E207 (= E201), A211 (≠ G205), D213 (≠ A206), G236 (= G229), L309 (≠ T301), S310 (= S302)
- binding calcium ion: E207 (= E201), A211 (≠ G205), D213 (≠ A206)
- binding magnesium ion: N244 (≠ R238)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N76), G182 (= G179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (= M183), G236 (= G229), V237 (≠ A230), T282 (≠ A277), S310 (= S302), G311 (= G303)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: T23 (= T22), P24 (= P23), L26 (≠ Q25), T27 (≠ R26), F46 (≠ L45)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
27% identity, 70% coverage: 22:308/408 of query aligns to 23:316/323 of 7nbdAAA
- active site: K53 (= K52), S81 (≠ A74), E207 (= E201), A211 (≠ G205), D213 (≠ A206), G236 (= G229), L309 (≠ T301), S310 (= S302)
- binding calcium ion: E207 (= E201), A211 (≠ G205), D213 (≠ A206)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ M266), L278 (≠ V273), V314 (≠ F306), L316 (≠ F308)
- binding magnesium ion: N244 (≠ R238)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N76), G182 (= G179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (= M183), G236 (= G229), V237 (≠ A230), E280 (= E275), T282 (≠ A277), S310 (= S302), G311 (= G303)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
27% identity, 70% coverage: 22:308/408 of query aligns to 23:316/323 of 7nbcCCC
- active site: K53 (= K52), S81 (≠ A74), E207 (= E201), A211 (≠ G205), D213 (≠ A206), G236 (= G229), L309 (≠ T301), S310 (= S302)
- binding biphenyl-4-ylacetic acid: T78 (≠ C71), H79 (≠ A72), H84 (= H77), V148 (≠ L144), H149 (≠ S145), P150 (= P146)
- binding calcium ion: E207 (= E201), A211 (≠ G205), D213 (≠ A206)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N76), G182 (= G179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (= M183), G236 (= G229), V237 (≠ A230), T282 (≠ A277), S310 (= S302), G311 (= G303)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
27% identity, 70% coverage: 22:308/408 of query aligns to 23:316/323 of 7nbcAAA
- active site: K53 (= K52), S81 (≠ A74), E207 (= E201), A211 (≠ G205), D213 (≠ A206), G236 (= G229), L309 (≠ T301), S310 (= S302)
- binding calcium ion: E207 (= E201), A211 (≠ G205), D213 (≠ A206)
- binding magnesium ion: N244 (≠ R238)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N76), G182 (= G179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (= M183), G236 (= G229), V237 (≠ A230), T282 (≠ A277), S310 (= S302), G311 (= G303)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
27% identity, 70% coverage: 22:308/408 of query aligns to 23:316/322 of 7nbgAAA
- active site: K53 (= K52), S81 (≠ A74), E207 (= E201), A211 (≠ G205), D213 (≠ A206), G236 (= G229), L309 (≠ T301), S310 (= S302)
- binding calcium ion: E207 (= E201), A211 (≠ G205), D213 (≠ A206)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N76), G182 (= G179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (= M183), G236 (= G229), V237 (≠ A230), T282 (≠ A277), S310 (= S302), G311 (= G303)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A74), G85 (≠ A78), Q86 (= Q79), I101 (= I94), K111 (= K104), I115 (≠ T108), Y118 (≠ F111)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
27% identity, 70% coverage: 22:307/408 of query aligns to 23:310/310 of 7nbgDDD
- active site: K53 (= K52), S76 (≠ A74), E202 (= E201), A206 (≠ G205), D208 (≠ A206), G231 (= G229), L304 (≠ T301), S305 (= S302)
- binding calcium ion: E202 (= E201), A206 (≠ G205), D208 (≠ A206)
- binding magnesium ion: N239 (≠ R238)
- binding ortho-xylene: S76 (≠ A74), Q81 (= Q79), I96 (= I94), Y113 (≠ F111)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N78 (= N76), G177 (= G179), G178 (= G180), G179 (= G181), G180 (= G182), M181 (= M183), G231 (= G229), V232 (≠ A230), E275 (= E275), T277 (≠ A277), S305 (= S302), G306 (= G303)
Sites not aligning to the query:
Query Sequence
>GFF3437 FitnessBrowser__Phaeo:GFF3437
MSDFQTQARAAEQAMRAIFPATPLQRSALLSERFGAEIYLKREDLSPVRSYKIRGAFNAM
RKQLEQSLFVCASAGNHAQGVAYMCRELGKRGVIFMPVTTPQQKIQKTRMFGGDSVEIHL
VGDYFDDTLAAAQKWCADEGGHFLSPFDDDDVIEGQSSIAVEIEAQLGAAPDHVILPVGG
GGMSSGVARWFGDRVHCLFAEPSGGACLRAALAAGHPVALDHVDTFVDGAAVGRVGARPF
EVLKQVPLPDVLSIAEDRICTTILEMLNVEGVVLEPAGALAIEALRDVRSWIRGKTVVCL
TSGGNFDFERLPEVKERAQRYMGLKKYFLLRLPQRPGALKEFLGILGPEDDIARFEYMKK
SARNFGSVLIGIETKRPENFADLYARLDAAGFAYTDITSDETLAQFVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory