SitesBLAST
Comparing GFF3445 FitnessBrowser__psRCH2:GFF3445 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yu7A Crystal structure of mhst in complex with l-tyrosine (see paper)
43% identity, 91% coverage: 7:446/486 of query aligns to 2:440/442 of 6yu7A
6yu4A Crystal structure of mhst in complex with l-4f-phenylalanine (see paper)
43% identity, 91% coverage: 7:446/486 of query aligns to 2:440/442 of 6yu4A
- binding 4-fluoro-l-phenylalanine: S18 (= S23), A19 (= A24), G21 (= G26), L22 (= L27), G23 (= G28), Y101 (= Y110), F223 (= F231), T224 (= T232), S226 (= S234), M229 (≠ S237), L321 (≠ M329)
6yu5A Crystal structure of mhst in complex with l-valine (see paper)
43% identity, 91% coverage: 7:446/486 of query aligns to 2:440/441 of 6yu5A
6yu3A Crystal structure of mhst in complex with l-phenylalanine (see paper)
43% identity, 91% coverage: 7:446/486 of query aligns to 2:440/441 of 6yu3A
6yu2A Crystal structure of mhst in complex with l-isoleucine (see paper)
43% identity, 91% coverage: 7:446/486 of query aligns to 2:440/441 of 6yu2A
4us3A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (see paper)
43% identity, 91% coverage: 7:446/486 of query aligns to 2:440/441 of 4us3A
- binding sodium ion: G17 (= G22), A19 (= A24), V20 (= V25), V20 (= V25), G21 (= G26), N24 (= N29), T224 (= T232), D256 (= D264), A313 (= A321), S316 (≠ T324), S317 (= S325)
- binding tryptophan: S18 (= S23), A19 (= A24), L22 (= L27), G23 (= G28), Y101 (= Y110), F223 (= F231), T224 (= T232), S226 (= S234), M229 (≠ S237), S320 (= S328), L321 (≠ M329)
6yu6B Crystal structure of mhst in complex with l-leucine (see paper)
43% identity, 91% coverage: 7:446/486 of query aligns to 2:440/446 of 6yu6B
4us4A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (lipidic cubic phase form) (see paper)
43% identity, 89% coverage: 15:446/486 of query aligns to 1:431/433 of 4us4A
- binding (2s)-2,3-dihydroxypropyl(7z)-pentadec-7-enoate: A173 (≠ I191), T180 (= T198), I287 (≠ M304), R288 (≠ P305), L289 (≠ F306)
- binding sodium ion: G8 (= G22), S9 (= S23), A10 (= A24), V11 (= V25), V11 (= V25), N15 (= N29), T215 (= T232), D247 (= D264), A304 (= A321), S307 (≠ T324), S308 (= S325)
- binding tryptophan: S9 (= S23), A10 (= A24), G12 (= G26), G14 (= G28), Y92 (= Y110), F214 (= F231), T215 (= T232), S217 (= S234), M220 (≠ S237), L312 (≠ M329)
3gwwA Leucine transporter leut in complex with s-fluoxetine (see paper)
29% identity, 79% coverage: 7:392/486 of query aligns to 1:417/501 of 3gwwA
- binding leucine: A18 (= A24), G20 (= G26), G22 (= G28), Y104 (= Y110), F244 (= F231), T245 (= T232), S247 (= S234), F250 (≠ S237), I350 (≠ M329)
- binding (3S)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L27), G22 (= G28), R26 (≠ K32), Y104 (= Y110), A310 (≠ G289), F311 (≠ P290), D392 (≠ N368), D395 (≠ S371)
7wlwA X-ray structure of thermostabilized drosophila dopamine transporter with gaba transporter1-like substitutions in the binding site, in complex with skf89976a (see paper)
25% identity, 93% coverage: 5:455/486 of query aligns to 1:480/536 of 7wlwA
- binding (3S)-1-(4,4-diphenylbut-3-enyl)piperidine-3-carboxylic acid: Y19 (≠ S23), G22 (= G26), L23 (= L27), A24 (≠ G28), L96 (≠ I106), Y99 (≠ F109), Y100 (= Y110), T250 (≠ G227), F253 (= F230), F254 (= F231), F254 (= F231), G257 (≠ S234), P258 (≠ L235), L260 (≠ S237), P321 (= P290), D410 (= D385), A414 (≠ S389)
- binding cholesterol: I17 (≠ T21), Y208 (≠ G184), L212 (= L188)
- binding decyl-beta-d-maltopyranoside: R109 (≠ A119), F112 (≠ V122), Y154 (≠ N147), L176 (≠ V158)
- binding cholesterol hemisuccinate: L49 (≠ I53), G451 (≠ L422), Y453 (= Y424)
7wgtA X-ray structure of thermostabilized drosophila dopamine transporter with gaba transporter1-like substitutions in the binding site, in complex with no711. (see paper)
25% identity, 93% coverage: 5:455/486 of query aligns to 1:480/536 of 7wgtA
- binding 1-(2-{[(diphenylmethylidene)amino]oxy}ethyl)-1,2,5,6-tetrahydropyridine-3-carboxylic acid: Y19 (≠ S23), G22 (= G26), A24 (≠ G28), L96 (≠ I106), F253 (= F230), F254 (= F231), G257 (≠ S234), P258 (≠ L235), A414 (≠ S389), I418 (≠ M393)
- binding cholesterol: Y208 (≠ G184), L212 (= L188)
- binding cholesterol hemisuccinate: Y277 (≠ A254), S288 (≠ T265), A289 (≠ C266), G451 (≠ L422), W454 (= W427)
2q6hA Crystal structure analysis of leut complexed with l-leucine, sodium, and clomipramine (see paper)
29% identity, 79% coverage: 7:392/486 of query aligns to 3:422/512 of 2q6hA
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R28 (≠ K32), Q32 (≠ I36), R189 (≠ N176), F190 (≠ A177), I193 (≠ W180), F316 (≠ P290), F346 (≠ I320), L396 (≠ F367), D397 (≠ N368)
- binding leucine: A20 (= A24), G22 (= G26), G24 (= G28), Y106 (= Y110), F249 (= F231), T250 (= T232), S252 (= S234), F255 (≠ S237)
- binding sodium ion: G18 (= G22), A20 (= A24), V21 (= V25), V21 (= V25), G22 (= G26), N25 (= N29), T250 (= T232), N282 (≠ D264), A347 (= A321), T350 (= T324), S351 (= S325)
3gwvA Leucine transporter leut in complex with r-fluoxetine (see paper)
29% identity, 79% coverage: 7:392/486 of query aligns to 1:420/498 of 3gwvA
- binding leucine: A18 (= A24), G20 (= G26), G22 (= G28), Y104 (= Y110), F247 (= F231), T248 (= T232), S250 (= S234), F253 (≠ S237)
- binding (3R)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L27), R26 (≠ K32), A313 (≠ G289), F314 (≠ P290), L394 (≠ F367), D395 (≠ N368), D398 (≠ S371)
2qeiA Crystal structure analysis of leut complexed with l-alanine, sodium, and clomipramine (see paper)
29% identity, 79% coverage: 7:392/486 of query aligns to 2:421/511 of 2qeiA
- binding alanine: A19 (= A24), G21 (= G26), G23 (= G28), Y105 (= Y110), F248 (= F231), T249 (= T232), S251 (= S234)
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K32), V30 (≠ Y35), Q31 (≠ I36), Y104 (≠ F109), R180 (≠ K168), R188 (≠ N176), F189 (≠ A177), F315 (≠ P290), F345 (≠ I320), D396 (≠ N368), D399 (≠ S371)
- binding sodium ion: G17 (= G22), A19 (= A24), V20 (= V25), V20 (= V25), G21 (= G26), N24 (= N29), T249 (= T232), N281 (≠ D264), A346 (= A321), T349 (= T324), S350 (= S325)
2q72A Crystal structure analysis of leut complexed with l-leucine, sodium, and imipramine (see paper)
29% identity, 79% coverage: 7:392/486 of query aligns to 2:421/511 of 2q72A
- binding 3-(5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K32), V30 (≠ Y35), Q31 (≠ I36), R188 (≠ N176), F189 (≠ A177), I192 (≠ W180), A314 (≠ G289), F315 (≠ P290), F345 (≠ I320), D396 (≠ N368)
- binding leucine: A19 (= A24), G21 (= G26), L22 (= L27), G23 (= G28), Y105 (= Y110), F248 (= F231), T249 (= T232), S251 (= S234), F254 (≠ S237)
- binding sodium ion: G17 (= G22), A19 (= A24), V20 (= V25), V20 (= V25), G21 (= G26), N24 (= N29), T249 (= T232), N281 (≠ D264), A346 (= A321), T349 (= T324), S350 (= S325)
3gwuA Leucine transporter leut in complex with sertraline (see paper)
29% identity, 79% coverage: 7:392/486 of query aligns to 1:420/509 of 3gwuA
- binding leucine: A18 (= A24), G20 (= G26), G22 (= G28), Y104 (= Y110), F247 (= F231), T248 (= T232), S250 (= S234), F253 (≠ S237)
- binding (1S,4S)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine: L25 (≠ W31), R26 (≠ K32), Y104 (= Y110), F247 (= F231), A313 (≠ G289), D395 (≠ N368), D398 (≠ S371)
3f4jA Crystal structure of leut bound to glycine and sodium (see paper)
29% identity, 79% coverage: 7:392/486 of query aligns to 1:420/509 of 3f4jA
- binding glycine: A18 (= A24), G20 (= G26), G22 (= G28), Y104 (= Y110), F247 (= F231), T248 (= T232), S250 (= S234)
- binding sodium ion: G16 (= G22), A18 (= A24), V19 (= V25), V19 (= V25), G20 (= G26), G22 (= G28), N23 (= N29), T248 (= T232), N280 (≠ D264), A345 (= A321), G346 (≠ A322), T348 (= T324), S349 (= S325)
3f3dA Crystal structure of leut bound to l-methionine and sodium (see paper)
29% identity, 79% coverage: 7:392/486 of query aligns to 1:420/509 of 3f3dA
- binding methionine: N17 (≠ S23), A18 (= A24), G20 (= G26), G22 (= G28), Y104 (= Y110), F247 (= F231), T248 (= T232), S250 (= S234), S349 (= S325), I353 (≠ M329)
- binding sodium ion: G16 (= G22), A18 (= A24), V19 (= V25), V19 (= V25), G20 (= G26), N23 (= N29), T248 (= T232), N280 (≠ D264), A345 (= A321), T348 (= T324), S349 (= S325)
3f3cA Crystal structure of leut bound to 4-fluoro-l-phenylalanine and sodium (see paper)
29% identity, 79% coverage: 7:392/486 of query aligns to 1:420/509 of 3f3cA
- binding sodium ion: G16 (= G22), A18 (= A24), V19 (= V25), V19 (= V25), G20 (= G26), N23 (= N29), T248 (= T232), N280 (≠ D264), A345 (= A321), T348 (= T324), S349 (= S325)
- binding 4-fluoro-l-phenylalanine: N17 (≠ S23), A18 (= A24), G20 (= G26), G22 (= G28), Y104 (= Y110), F247 (= F231), T248 (= T232), S250 (= S234), F253 (≠ S237), S349 (= S325), I353 (≠ M329)
2qb4A Crystal structure analysis of leut complexed with l-leucine, sodium and desipramine (see paper)
29% identity, 79% coverage: 7:392/486 of query aligns to 1:420/510 of 2qb4A
- binding 3-(10,11-dihydro-5h-dibenzo[b,f]azepin-5-yl)-n-methylpropan-1-amine: R26 (≠ K32), V29 (≠ Y35), Q30 (≠ I36), I107 (≠ V113), R187 (≠ N176), F188 (≠ A177), I191 (≠ W180), A313 (≠ G289), F314 (≠ P290), F344 (≠ I320), D395 (≠ N368)
- binding leucine: A18 (= A24), G20 (= G26), L21 (= L27), G22 (= G28), Y104 (= Y110), F247 (= F231), T248 (= T232), S250 (= S234), F253 (≠ S237)
- binding sodium ion: G16 (= G22), A18 (= A24), V19 (= V25), V19 (= V25), G20 (= G26), N23 (= N29), T248 (= T232), N280 (≠ D264), A345 (= A321), T348 (= T324), S349 (= S325)
Query Sequence
>GFF3445 FitnessBrowser__psRCH2:GFF3445
MTREKPKNLWLSRWGFILAATGSAVGLGNIWKFPYITGEFGGGAFVLMYLLCILAIGVPV
MMCEIAIGRRGRGSPIDAIGRVVRENNGNPLWKAVGGMAMTAGFLILCFYVVVAGWAFAY
TVKMLDGSLAATSVEALGGVFEAHNSNPWQLGGWSLLVALLTLWIVAKGVQKGIENAVRW
MMPGLAVLLLILVGYAVTSGGFDQGFAFLFSFDTSKITGEALLAALGHAFFTLSLASGAI
LTYGSYIPDDQSIARTTFMVAIADTCVALLAGLAIFPIIFANGMDPTAGPGLIFMSLPLA
FQQMPFGTAFGVLFFAMVSIAALTSAISMIEATVAYLNEKHGISRLKAAMGSGAVLLVIS
MLAMLSFNLMSGWTPMGKNFFDWLDYLTSRWMMPLGGIFTVLLAGYALRSEIMRDELNLP
PLGYALWLFMVRYVCPVLILMVFLHALGWLGFDPLQRWYWIAGAIGALTLVGELLRPRVM
PALAGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory