Comparing GFF3448 FitnessBrowser__psRCH2:GFF3448 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q88E47 Homogentisate 1,2-dioxygenase; HGDO; Homogentisate oxygenase; Homogentisic acid oxidase; Homogentisicase; EC 1.13.11.5 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
25% identity, 74% coverage: 73:354/379 of query aligns to 112:401/433 of Q88E47
3zdsA Structure of homogentisate 1,2-dioxygenase in complex with reaction intermediates of homogentisate with oxygen. (see paper)
25% identity, 74% coverage: 73:354/379 of query aligns to 104:393/425 of 3zdsA
4aq6D Substrate bound homogentisate 1,2-dioxygenase (see paper)
25% identity, 74% coverage: 73:354/379 of query aligns to 106:395/427 of 4aq6D
3zdsF Structure of homogentisate 1,2-dioxygenase in complex with reaction intermediates of homogentisate with oxygen. (see paper)
25% identity, 74% coverage: 73:354/379 of query aligns to 105:394/426 of 3zdsF
3zdsC Structure of homogentisate 1,2-dioxygenase in complex with reaction intermediates of homogentisate with oxygen. (see paper)
25% identity, 74% coverage: 73:354/379 of query aligns to 105:394/426 of 3zdsC
Q93099 Homogentisate 1,2-dioxygenase; Homogentisate oxygenase; Homogentisic acid oxidase; Homogentisicase; EC 1.13.11.5 from Homo sapiens (Human) (see 13 papers)
23% identity, 72% coverage: 86:356/379 of query aligns to 128:408/445 of Q93099
Sites not aligning to the query:
Q9Y041 Homogentisate 1,2-dioxygenase; Homogentisate oxygenase; Homogentisic acid oxidase; Homogentisicase; EC 1.13.11.5 from Caenorhabditis elegans (see paper)
23% identity, 81% coverage: 66:373/379 of query aligns to 118:427/437 of Q9Y041
1ey2A Human homogentisate dioxygenase with fe(ii) (see paper)
23% identity, 72% coverage: 86:356/379 of query aligns to 127:399/419 of 1ey2A
>GFF3448 FitnessBrowser__psRCH2:GFF3448
MSRKWISFPIREGESSRQAHCDFPQGTYEREMGREGFFGPASHLHHKHPPTGWIDWEGPL
RPHAFNFNQIPSEGDCPLQAPLALHNADVKLRLWKTNGAMRHLVRNGDGDELLFIHEGAG
HLYCDFGHLEFRDGDYLMIPRGTAWRIEATQPVFMLLIENTDGAYQLPDKGLVGPHAIFD
AAVLDHPRLDDAFRAQQDENPWQIRIKRRDQITTVTYPYNPLDVVGWHGDNTVVRLNWRD
IRPLMSHRYHLPPSAHTTFVANGFVVCTFTPRPVESDPGALKVPFFHNNDDYDEVLFYHR
GNFFSRDNIEQGMVTFHPCGFPHGPHPKALKKAQDDPATFADEVAVMIDTRRALEVGEAA
AAVDVPEYVNSWRAPGKES
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory