Comparing GFF3581 FitnessBrowser__Phaeo:GFF3581 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
4f0lB Crystal structure of amidohydrolase from brucella melitensis
49% identity, 99% coverage: 4:453/455 of query aligns to 5:449/449 of 4f0lB
Q9HU77 Formimidoylglutamate deiminase; Formiminoglutamate deiminase; N-formimino-L-glutamate deiminase; N-formimino-L-glutamate iminohydrolase; EC 3.5.3.13 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
48% identity, 99% coverage: 1:452/455 of query aligns to 1:452/453 of Q9HU77
4rdvB The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-formimino-l-aspartate
48% identity, 99% coverage: 3:452/455 of query aligns to 2:451/451 of 4rdvB
3mduA The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-guanidino-l-glutamate (see paper)
49% identity, 96% coverage: 3:439/455 of query aligns to 2:438/450 of 3mduA
4dzhA Crystal structure of an adenosine deaminase from xanthomonas campestris (target nysgrc-200456) with bound zn
30% identity, 46% coverage: 217:426/455 of query aligns to 203:409/439 of 4dzhA
Sites not aligning to the query:
3hpaA Crystal structure of an amidohydrolase gi:44264246 from an evironmental sample of sargasso sea (see paper)
25% identity, 96% coverage: 18:454/455 of query aligns to 23:426/428 of 3hpaA
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
22% identity, 87% coverage: 31:426/455 of query aligns to 45:405/436 of 4f0rA
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
22% identity, 87% coverage: 31:426/455 of query aligns to 45:405/434 of 4f0sA
3lnpA Crystal structure of amidohydrolase family protein olei01672_1_465 from oleispira antarctica (see paper)
20% identity, 96% coverage: 16:451/455 of query aligns to 23:438/441 of 3lnpA
8is4A Structure of an isocytosine specific deaminase vcz in complexed with 5-fu (see paper)
24% identity, 80% coverage: 41:403/455 of query aligns to 52:399/452 of 8is4A
4gbdA Crystal structure of adenosine deaminase from pseudomonas aeruginosa pao1 with bound zn and methylthio-coformycin (see paper)
25% identity, 53% coverage: 202:443/455 of query aligns to 183:425/435 of 4gbdA
Sites not aligning to the query:
4dykA Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
25% identity, 53% coverage: 202:443/455 of query aligns to 183:425/437 of 4dykA
Sites not aligning to the query:
6ohbA E. Coli guanine deaminase (see paper)
27% identity, 49% coverage: 204:428/455 of query aligns to 201:431/435 of 6ohbA
Sites not aligning to the query:
Q58936 5'-deoxyadenosine deaminase; 5'-dA deaminase; 5'-methylthioadenosine deaminase; MTA deaminase; Adenosine deaminase; S-adenosylhomocysteine deaminase; SAH deaminase; EC 3.5.4.41; EC 3.5.4.31; EC 3.5.4.4; EC 3.5.4.28 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
25% identity, 56% coverage: 181:433/455 of query aligns to 159:398/420 of Q58936
Sites not aligning to the query:
6ohaA Yeast guanine deaminase (see paper)
25% identity, 43% coverage: 235:428/455 of query aligns to 257:448/451 of 6ohaA
Sites not aligning to the query:
>GFF3581 FitnessBrowser__Phaeo:GFF3581
MQTIFAQHARMPQGWVTDLRLTIEAGKIATLEPGAAVQPQDHRVGALVPALANLHSHSFQ
RAMAGMTETRVSGRDSFWSWRKLMYQFVDHLTPEQYEAIAALVFMEMLEAGYASVGEFHY
VHHQPGGQPYEVLGELSHRVFAAADLTGIGLTHLPVLYTYGGAGQAPLGGGQQRFGNDVT
RYANLLSDCRTTARELLPMDARVGIAPHSLRATAPDELAEVLTLRAESPVHIHIAEQPQE
VADIGGWLGERPVQWLLNNCAVDKDWCLIHATHMTEQETHDLARSGAVAGLCPITEANLG
DGPFNGVLFQNNGGRFGVGSDSNIRISLSEELRLLEYSQRLRDLARNVMVPEEGSVGAAL
YLGAACGGAQALGRDAGRLEVGALADLMAFDTTDVTLCALRPDQFLDGLCFAADDSVVRD
VWSAGRHVVSGGRHANREQIIARYNSAVAALLSAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory