Comparing GFF3629 FitnessBrowser__Phaeo:GFF3629 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
41% identity, 89% coverage: 8:303/332 of query aligns to 2:306/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
37% identity, 89% coverage: 26:320/332 of query aligns to 21:316/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
36% identity, 89% coverage: 26:320/332 of query aligns to 20:305/310 of 4fwiB
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
41% identity, 78% coverage: 7:265/332 of query aligns to 1:250/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
41% identity, 78% coverage: 7:265/332 of query aligns to 1:250/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
40% identity, 78% coverage: 7:265/332 of query aligns to 1:250/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 79% coverage: 9:269/332 of query aligns to 1:256/343 of P30750
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 77% coverage: 8:262/332 of query aligns to 1:239/241 of 4u00A
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 79% coverage: 9:269/332 of query aligns to 2:257/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 79% coverage: 9:269/332 of query aligns to 2:257/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 79% coverage: 9:269/332 of query aligns to 2:257/344 of 6cvlD
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 72% coverage: 28:266/332 of query aligns to 41:270/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
33% identity, 72% coverage: 28:266/332 of query aligns to 41:270/382 of 7aheC
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
33% identity, 71% coverage: 9:244/332 of query aligns to 1:230/232 of 1f3oA
3c4jA Abc protein artp in complex with atp-gamma-s
34% identity, 77% coverage: 9:262/332 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
34% identity, 77% coverage: 9:262/332 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
34% identity, 77% coverage: 9:262/332 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
34% identity, 77% coverage: 9:262/332 of query aligns to 3:241/242 of 2oljA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
33% identity, 71% coverage: 9:244/332 of query aligns to 1:230/230 of 1l2tA
7ahdC Opua (e190q) occluded (see paper)
33% identity, 68% coverage: 28:254/332 of query aligns to 41:258/260 of 7ahdC
Sites not aligning to the query:
>GFF3629 FitnessBrowser__Phaeo:GFF3629
MTMKETQPVLEVRNLCTTFKRGGVLLPAVRDVSFDVRQGEVLGLVGESGSGKSVTLRSIL
GLTRRHGEVTGEVRWQGRDISRLSDRQLRQVRGGEVAMIFQEPMTSLNPLLTVGLQLTET
LKAHTDLSRAARRNRAIEMLDHVGIPAAASRLQDYPHQFSGGMRQRVMIAIALAAEPKLL
LADEPTTALDVTIQAQILDLILRLSQEMNMGVILVTHDLGVVAQTCENVAVMYAGRIVEQ
GAVRQVLRAPRHPYTAGLMRSVPQDIAPRTPLYSVPGTPPSLEMLPRGCAYAPRCEVRTE
ACLSKRPALETISAGRRAACFNPVPSIQGEVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory