Comparing GFF3711 FitnessBrowser__Marino:GFF3711 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P11436 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
85% identity, 99% coverage: 1:346/348 of query aligns to 1:346/346 of P11436
Q9RQ17 Aliphatic amidase; Acylamide amidohydrolase; Wide spectrum amidase; EC 3.5.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
83% identity, 99% coverage: 1:346/348 of query aligns to 1:346/348 of Q9RQ17
4gylA The e142l mutant of the amidase from geobacillus pallidus showing the result of michael addition of acrylamide at the active site cysteine (see paper)
83% identity, 97% coverage: 1:338/348 of query aligns to 1:338/340 of 4gylA
O25067 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
78% identity, 97% coverage: 1:338/348 of query aligns to 1:337/339 of O25067
O25836 Formamidase; Formamide amidohydrolase; EC 3.5.1.49 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
38% identity, 82% coverage: 15:298/348 of query aligns to 16:297/334 of O25836
2e2lA Helicobacter pylori formamidase amif contains a fine-tuned cysteine- glutamate-lysine catalytic triad (see paper)
37% identity, 82% coverage: 15:298/348 of query aligns to 4:280/317 of 2e2lA
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
26% identity, 74% coverage: 21:278/348 of query aligns to 2:252/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
26% identity, 74% coverage: 21:278/348 of query aligns to 2:252/261 of 3klcA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
26% identity, 74% coverage: 21:278/348 of query aligns to 3:253/262 of Q9UYV8
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
26% identity, 66% coverage: 51:278/348 of query aligns to 41:260/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
26% identity, 66% coverage: 51:278/348 of query aligns to 35:254/263 of 7ovgA
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
25% identity, 45% coverage: 113:269/348 of query aligns to 106:285/304 of Q44185
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
29% identity, 44% coverage: 118:269/348 of query aligns to 96:248/254 of 4izuA
Sites not aligning to the query:
1uf8A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-phenylalanine
24% identity, 45% coverage: 113:269/348 of query aligns to 105:284/303 of 1uf8A
Sites not aligning to the query:
1uf7A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-valine
24% identity, 45% coverage: 113:269/348 of query aligns to 105:284/303 of 1uf7A
Sites not aligning to the query:
1uf5A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-methionine
24% identity, 45% coverage: 113:269/348 of query aligns to 105:284/303 of 1uf5A
Sites not aligning to the query:
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
24% identity, 68% coverage: 33:267/348 of query aligns to 19:255/276 of Q9NQR4
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
28% identity, 44% coverage: 118:269/348 of query aligns to 103:255/261 of 5nycA
Sites not aligning to the query:
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
28% identity, 44% coverage: 118:269/348 of query aligns to 103:255/261 of 4izsA
Sites not aligning to the query:
8hpcC Crystal structure of c171a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-hydroxyphenylglycine
24% identity, 45% coverage: 113:269/348 of query aligns to 105:284/303 of 8hpcC
Sites not aligning to the query:
>GFF3711 FitnessBrowser__Marino:GFF3711
MRHGDISSSNDTVGVAVVNYKMPRLHTKAEVLDNARNIADMIKGMKVGLPGMDLVVFPEY
STMGIMYDNEEMMETAATVPGDETAIFSAACREANTWGVFSLTGERHEDHPNKAPYNTLV
LINNEGEVVQKYRKCIPWCPIEGWYPGDTTYVTEGPKGMKISLIICDDGNYPEIWRDCAM
KGAELIVRCQGYMYPAKEQQVMMAKSMAWANNCYVAVANAAGFDGVYSYFGHSAIIGFDG
RTLGECGEEDMGIQYAQLSVSQIRDARANDQSQNHLFKLLHRGYTGVHASGDGDKGVADC
PFEFYRTWVMDAQKAQENVEAMTRKTVGTAECPVGELPFDGKEKSAGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory