SitesBLAST
Comparing GFF39 FitnessBrowser__psRCH2:GFF39 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2fuvA Phosphoglucomutase from salmonella typhimurium.
60% identity, 99% coverage: 2:552/554 of query aligns to 1:542/545 of 2fuvA
6snoA Crystal structures of human pgm1 isoform 2 (see paper)
28% identity, 75% coverage: 43:458/554 of query aligns to 31:442/573 of 6snoA
- active site: R36 (= R48), S130 (= S154), H131 (= H155), K143 (= K164), D301 (= D312), D303 (= D314), D305 (= D316), R306 (= R317), G393 (= G403)
- binding 1-O-phosphono-alpha-D-glucopyranose: S130 (= S154), E389 (= E399), S391 (= S401)
- binding zinc ion: S130 (= S154), D301 (= D312), D303 (= D314), D305 (= D316)
Sites not aligning to the query:
6snqA Crystal structures of human pgm1 isoform 2 (see paper)
28% identity, 75% coverage: 43:458/554 of query aligns to 31:442/566 of 6snqA
- active site: R36 (= R48), S130 (= S154), H131 (= H155), K143 (= K164), D301 (= D312), D303 (= D314), D305 (= D316), R306 (= R317), G393 (= G403)
- binding 6-O-phosphono-alpha-D-glucopyranose: S130 (= S154), T370 (≠ V380), G371 (= G381), E389 (= E399), S391 (= S401)
- binding zinc ion: S130 (= S154), D301 (= D312), D303 (= D314), D305 (= D316)
Sites not aligning to the query:
3pmgA Structure of rabbit muscle phosphoglucomutase at 2.4 angstroms resolution. Use of freezing point depressant and reduced temperature to enhance diffractivity (see paper)
28% identity, 75% coverage: 43:458/554 of query aligns to 17:428/561 of 3pmgA
- active site: R22 (vs. gap), S116 (= S154), H117 (= H155), K129 (= K164), D287 (= D312), D289 (= D314), D291 (= D316), R292 (= R317), G379 (= G403), K388 (= K418)
- binding magnesium ion: S116 (= S154), D287 (= D312), D289 (= D314), D291 (= D316)
1c4gA Phosphoglucomutase vanadate based transition state analog complex
28% identity, 75% coverage: 43:458/554 of query aligns to 17:428/561 of 1c4gA
- active site: R22 (vs. gap), S116 (= S154), H117 (= H155), K129 (= K164), D287 (= D312), D289 (= D314), D291 (= D316), R292 (= R317), G379 (= G403), K388 (= K418)
- binding cobalt (ii) ion: S116 (= S154), D287 (= D312), D289 (= D314), D291 (= D316)
- binding alpha-d-glucose-1-phosphate-6-vanadate: R22 (vs. gap), S116 (= S154), H117 (= H155), K129 (= K164), R292 (= R317), E375 (= E399), S377 (= S401), K388 (= K418)
Sites not aligning to the query:
1c47A Binding driven structural changes in crystaline phosphoglucomutase associated with chemical reaction
28% identity, 75% coverage: 43:458/554 of query aligns to 17:428/561 of 1c47A
- active site: R22 (vs. gap), S116 (= S154), H117 (= H155), K129 (= K164), D287 (= D312), D289 (= D314), D291 (= D316), R292 (= R317), G379 (= G403), K388 (= K418)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: R22 (vs. gap), S116 (= S154), D291 (= D316), R292 (= R317), E375 (= E399), K388 (= K418)
P00949 Phosphoglucomutase-1; PGM 1; Glucose phosphomutase 1; EC 5.4.2.2 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
28% identity, 75% coverage: 43:458/554 of query aligns to 18:429/562 of P00949
- R23 (vs. gap) binding
- S117 (= S154) active site, Phosphoserine intermediate; binding ; binding via phosphate group; modified: Phosphoserine
- D288 (= D312) binding
- D290 (= D314) binding
- D292 (= D316) binding ; binding
- R293 (= R317) binding
- T357 (≠ V380) binding
- E376 (= E399) binding
- S378 (= S401) binding
- K389 (= K418) binding
P36871 Phosphoglucomutase-1; PGM 1; Glucose phosphomutase 1; EC 5.4.2.2 from Homo sapiens (Human) (see 11 papers)
28% identity, 75% coverage: 43:458/554 of query aligns to 18:429/562 of P36871
- T19 (= T44) to A: in CDG1T; strongly reduces phosphoglucomutase activity; dbSNP:rs1320810473
- N38 (≠ W59) to Y: in CDG1T; strongly reduces solubility; increases aggregation; dbSNP:rs587777402
- Q41 (≠ L62) to R: in CDG1T; reduces solubility; increases aggregation; dbSNP:rs1300651770
- D62 (= D86) to H: in CDG1T; reduces solubility; reduces strongly phosphoglucomutase activity; dbSNP:rs587777403
- K68 (≠ E92) to M: in allele PGM1*7+, allele PGM1*7-, allele PGM1*3+ and allele PGM1*3-; phosphoglucomutase activity is similar to wild-type; dbSNP:rs200390982
- T115 (= T152) to A: in CDG1T; reduces mildly phosphoglucomutase activity; dbSNP:rs121918371
- S117 (= S154) active site, Phosphoserine intermediate; binding via phosphate groupe; modified: Phosphoserine
- G121 (vs. gap) to R: in CDG1T; there is 7% enzyme residual phosphoglucomutase activity; dbSNP:rs398122912
- R221 (≠ A240) to C: in allele PGM1*2+, allele PGM1*2-, allele PGM1*3+ and allele PGM1*3-; phosphoglucomutase activity is similar to wild-type; dbSNP:rs1126728
- D263 (= D288) to G: in CDG1T; strongly reduces phosphoglucomutase activity; dbSNP:rs1465877146; to Y: in CDG1T; strongly reduces phosphoglucomutase activity; dbSNP:rs587777404
- D288 (= D312) binding
- D290 (= D314) binding
- G291 (≠ H315) to R: in CDG1T; strongly reduces phosphoglucomutase activity; dbSNP:rs772768778
- D292 (= D316) binding
- G330 (= G353) to R: in CDG1T; decreases mildly solubility; dbSNP:rs777164338
- E377 (= E400) to K: in CDG1T; decreases strongly solubility
- E388 (≠ D417) to K: in CDG1T; decreases strongly solubility; dbSNP:rs1301021797
- Y420 (≠ F449) to H: in allele PGM1*1-, allele PGM1*2-, allele PGM1*3- and allele PGM1*7-; phosphoglucomutase activity is similar to wild-type; dbSNP:rs11208257
Sites not aligning to the query:
- 467 modified: Phosphothreonine; by PAK1
- 516 L → P: in CDG1T; decreases strongly solubility; dbSNP:rs587777401
7s0wB Crystal structure of the t337m variant of human pgm-1 (see paper)
28% identity, 68% coverage: 43:416/554 of query aligns to 19:396/499 of 7s0wB
5jn5A Crystal structure of the d263y missense variant of human pgm1 (see paper)
27% identity, 75% coverage: 43:458/554 of query aligns to 19:430/559 of 5jn5A
- active site: R24 (= R48), S118 (= S154), H119 (= H155), K131 (= K164), D289 (= D312), D291 (= D314), D293 (= D316), R294 (= R317), G381 (= G403), K390 (= K418)
- binding calcium ion: S118 (= S154), D289 (= D312), D291 (= D314), D293 (= D316)
6y8yA Structure of baltic herring (clupea harengus) phosphoglucomutase 5 (pgm5) with bound glucose-1-phosphate (see paper)
26% identity, 78% coverage: 31:461/554 of query aligns to 10:441/572 of 6y8yA
Sites not aligning to the query:
7pjcB The structure of candida albicans phosphoglucomutase with isothiazolone modification on cys359
26% identity, 91% coverage: 34:538/554 of query aligns to 7:522/553 of 7pjcB
Q9VUY9 Phosphoglucomutase; PGM; Glucose phosphomutase; EC 5.4.2.2 from Drosophila melanogaster (Fruit fly) (see 4 papers)
26% identity, 85% coverage: 81:552/554 of query aligns to 56:542/560 of Q9VUY9
- S116 (= S154) modified: Phosphoserine
- E351 (≠ R374) natural variant: E -> K
Sites not aligning to the query:
- 6 natural variant: E -> G
- 17 natural variant: K -> Q
- 28 natural variant: K -> N
- 36 natural variant: T -> M
4qg5A Crystal structure of phosphoglucomutase from leishmania major at 3.5 angstrom resolution
27% identity, 68% coverage: 42:416/554 of query aligns to 1:392/565 of 4qg5A
1kfqA Crystal structure of exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutse) from paramecium. Open form (see paper)
25% identity, 64% coverage: 65:416/554 of query aligns to 42:410/571 of 1kfqA
1kfiA Crystal structure of the exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutase) from paramecium (see paper)
25% identity, 64% coverage: 65:416/554 of query aligns to 41:409/570 of 1kfiA
- active site: S124 (= S154), H125 (= H155), D306 (= D312), D308 (= D314), D310 (= D316), R311 (= R317), K403 (≠ Q410)
- binding sulfate ion: S124 (= S154), H125 (= H155), D310 (= D316), R311 (= R317)
- binding zinc ion: D306 (= D312), D308 (= D314), D310 (= D316)
Sites not aligning to the query:
O74374 Phosphoglucomutase; PGM; Glucose phosphomutase; EC 5.4.2.2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 53% coverage: 120:414/554 of query aligns to 85:382/554 of O74374
- T111 (= T152) modified: Phosphothreonine
- S113 (= S154) modified: Phosphoserine
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
25% identity, 88% coverage: 42:530/554 of query aligns to 5:433/455 of 1wqaA
- active site: R11 (= R48), S101 (= S154), H102 (= H155), K111 (= K164), D243 (= D312), D245 (= D314), D247 (= D316), R248 (= R317), G330 (= G403), R340 (≠ K418)
- binding magnesium ion: S101 (= S154), D243 (= D312), D245 (= D314), D247 (= D316)
P18159 Phosphoglucomutase; PGM; Alpha-phosphoglucomutase; Glucose phosphomutase; EC 5.4.2.2 from Bacillus subtilis (strain 168) (see paper)
23% identity, 88% coverage: 38:527/554 of query aligns to 40:546/581 of P18159
- G162 (= G170) mutation to D: Very low enzymatic activity. Great decrease in biofilm formation. Deformed cell morphology.
- T240 (≠ A247) mutation to I: Impaired enzymatic activity. Great decrease in biofilm formation. Deformed cell morphology.
- G407 (= G403) mutation to D: Loss of enzymatic activity. Great decrease in biofilm formation. Deformed cell morphology.
- D418 (= D419) mutation to N: Impaired enzymatic activity. Great decrease in biofilm formation. Deformed cell morphology.
7p5oB Crystal structure of aspergillus fumigatus phosphoglucomutase in complex with the reaction intermediate
26% identity, 53% coverage: 120:415/554 of query aligns to 89:387/558 of 7p5oB
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: S117 (= S154), H118 (= H155), K130 (= K164), D286 (= D316), R287 (= R317), T350 (≠ V380), E369 (= E399), S371 (= S401), K382 (≠ Q410)
- binding magnesium ion: S117 (= S154), D282 (= D312), D284 (= D314), D286 (= D316)
Sites not aligning to the query:
Query Sequence
>GFF39 FitnessBrowser__psRCH2:GFF39
MSIAANAGRLPDPHTLTHLPRLVARYYSDRPDPSDPAQQVAFGTSGHRGSSLKGSFNEWH
ILATTQAICDYRRQEGIDGPLFMGMDTHALSEPAFISALEVLAANGIETRIDAGCAETGG
EPGYTPTPAISNAILSYNRGRTSGLADGIVITPSHNPPGDGGFKYNPTNGGPADTGVTKW
IQERANALLVAGLEGVKRMDYRQALKATTTQRFDFIDAYVGGLERVIDLDAIRGSGLKFA
VDPLGGAGVHYWPRIAERFGLPLEVLSTVVDPTFRFMRLDWDGKIRMDCSSPHAMAGLIE
NKDRFDVAFACDTDHDRHGIVTRSGGLMNPNHYLAVAIEYLFTHRPGWSAEAGIGKTLVS
SSMIDRVAAGIERRLVEVPVGFKWFVDGLMDGSLGFGGEESAGASFLDKQGGAWSTDKDG
LILGLLAAEITAVTGKDPSERYQALTDRFGAPVYQRIDAAANREQKARLGKLSASQVSAK
ELAGQPITRILTEAPGNGAAIGGLKVETANGWFAARPSGTEDVYKIYAESFEGEAHLKRI
QAEAKALVDSVLAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory