SitesBLAST
Comparing GFF3914 FitnessBrowser__Phaeo:GFF3914 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
44% identity, 51% coverage: 251:566/615 of query aligns to 3:303/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G279), G34 (= G282), T35 (≠ S283), I36 (= I284), D56 (≠ E304), H57 (≠ L305), S82 (= S334), I83 (≠ V335), A104 (= A356), A105 (= A357), A106 (= A358), K108 (= K360), N123 (= N375), I146 (= I398), K162 (= K414), F184 (= F438), G185 (= G439), N186 (= N440), V187 (= V441), S190 (= S444), S191 (= S445)
- binding uridine-5'-diphosphate: K150 (= K402), N186 (= N440), S193 (= S447), V194 (= V448), T209 (= T463), L210 (≠ V464), T211 (= T465), I215 (≠ V469), R217 (= R471), E279 (= E542)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
44% identity, 51% coverage: 251:566/615 of query aligns to 3:303/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G279), G34 (= G282), T35 (≠ S283), I36 (= I284), D56 (≠ E304), H57 (≠ L305), S82 (= S334), I83 (≠ V335), A104 (= A356), A105 (= A357), A106 (= A358), K108 (= K360), N123 (= N375), I146 (= I398), K162 (= K414), F184 (= F438), G185 (= G439), N186 (= N440), V187 (= V441), S190 (= S444), S191 (= S445)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K360), H109 (= H361), T148 (≠ S400), G185 (= G439), N186 (= N440), S193 (= S447), V194 (= V448), T209 (= T463), L210 (≠ V464), T211 (= T465), I215 (≠ V469), R217 (= R471), R276 (= R539), E279 (= E542)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
36% identity, 45% coverage: 270:548/615 of query aligns to 3:271/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G279), T14 (≠ G281), G15 (= G282), T16 (≠ S283), I17 (= I284), S37 (≠ E304), R38 (≠ L305), S39 (= S306), D63 (≠ S334), I64 (≠ V335), V83 (≠ A356), A84 (= A357), K87 (= K360), T125 (≠ I398), S127 (= S400), Y137 (≠ M410), K141 (= K414), F167 (= F438), V170 (= V441), S173 (= S444), R174 (≠ S445)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K360), H88 (= H361), S127 (= S400), N128 (≠ D401), Y137 (≠ M410), N169 (= N440), S176 (= S447), V177 (= V448), L180 (= L451), T192 (= T463), T194 (= T465), M198 (≠ V469), R200 (= R471), L234 (≠ I506), E265 (= E542)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
33% identity, 47% coverage: 270:555/615 of query aligns to 2:271/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G279), T13 (≠ G281), G14 (= G282), S15 (= S283), F16 (≠ I284), S36 (≠ E304), R37 (≠ L305), D38 (≠ S306), K41 (≠ A309), D60 (≠ S334), V61 (= V335), A80 (= A356), A81 (= A357), A82 (= A358), K84 (= K360), T99 (≠ N375), L122 (≠ I398), K138 (= K414), Y164 (≠ F438)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
33% identity, 47% coverage: 261:548/615 of query aligns to 3:272/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K360), Q94 (≠ H361), N175 (= N440), S179 (= S444), R180 (≠ S445), S182 (= S447), V183 (= V448), L186 (= L451), T198 (= T463), I199 (≠ V464), T200 (= T465), M204 (≠ V469), R206 (= R471), V240 (≠ L507), R263 (= R539), E266 (= E542)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
33% identity, 47% coverage: 261:548/615 of query aligns to 3:272/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G279), T22 (≠ G281), G23 (= G282), S24 (= S283), F25 (≠ I284), S45 (≠ E304), R46 (≠ L305), D47 (≠ S306), K50 (≠ A309), D69 (≠ S334), V70 (= V335), A89 (= A356), A90 (= A357), A91 (= A358), K93 (= K360), L131 (≠ I398), T133 (≠ S400), K147 (= K414), Y173 (≠ F438)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (≠ H361), V95 (= V362), K135 (= K402), N175 (= N440), S182 (= S447), V183 (= V448), L186 (= L451), T198 (= T463), T200 (= T465), M204 (≠ V469), V240 (≠ L507), R263 (= R539), E266 (= E542)
Sites not aligning to the query:
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: 278, 313, 314, 315, 316, 320
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
32% identity, 45% coverage: 270:548/615 of query aligns to 3:264/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G279), T14 (≠ G281), G15 (= G282), F17 (≠ I284), S37 (≠ E304), R38 (≠ L305), D39 (≠ S306), K42 (≠ A309), D61 (≠ S334), V62 (= V335), R63 (≠ T336), A81 (= A356), A82 (= A357), A83 (= A358), K85 (= K360), S124 (= S399), T125 (≠ S400), K139 (= K414), Y165 (≠ F438), G166 (= G439)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
31% identity, 45% coverage: 271:546/615 of query aligns to 3:259/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G279), T13 (≠ G281), G14 (= G282), S15 (= S283), F16 (≠ I284), S37 (≠ E304), R38 (≠ L305), D39 (≠ S306), K42 (≠ Q315), D61 (≠ S334), V62 (= V335), A81 (= A356), A82 (= A357), A83 (= A358), K85 (= K360), T100 (≠ N375), L123 (≠ I398), S124 (= S399), K139 (= K414), Y165 (≠ F438), G166 (= G439), V168 (= V441), S171 (= S444), R172 (≠ S445)
- binding uridine-5'-diphosphate: K127 (= K402), N167 (= N440), V175 (= V448), P191 (≠ T463), I192 (≠ V464), T193 (= T465), M197 (≠ V469), R199 (= R471), M233 (≠ I506), R252 (= R539)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
31% identity, 45% coverage: 271:546/615 of query aligns to 9:265/333 of O25511
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
31% identity, 45% coverage: 271:546/615 of query aligns to 5:261/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K360), S176 (= S447), V177 (= V448), T195 (= T465), M199 (≠ V469), R201 (= R471), M235 (≠ I506), R254 (= R539), E257 (= E542)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G279), T15 (≠ G281), G16 (= G282), S17 (= S283), F18 (≠ I284), S39 (≠ E304), R40 (≠ L305), D41 (≠ S306), K44 (≠ Q315), D63 (≠ S334), V64 (= V335), A83 (= A356), A84 (= A357), A85 (= A358), K87 (= K360), L125 (≠ I398), S126 (= S399), Y137 (≠ M410), K141 (= K414), Y167 (≠ F438), G168 (= G439), V170 (= V441)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
31% identity, 45% coverage: 271:546/615 of query aligns to 5:261/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G279), T15 (≠ G281), G16 (= G282), S17 (= S283), F18 (≠ I284), R40 (≠ L305), D41 (≠ S306), K44 (≠ Q315), D63 (≠ S334), V64 (= V335), A83 (= A356), A84 (= A357), A85 (= A358), K87 (= K360), L125 (≠ I398), S126 (= S399), K141 (= K414), Y167 (≠ F438), G168 (= G439), V170 (= V441), R174 (≠ S445)
- binding uridine-5'-diphosphate-glucose: K87 (= K360), T127 (≠ S400), K129 (= K402), Y137 (≠ M410), N169 (= N440), S176 (= S447), V177 (= V448), P193 (≠ T463), T195 (= T465), M199 (≠ V469), R201 (= R471), M235 (≠ I506), R254 (= R539), E257 (= E542)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
31% identity, 45% coverage: 271:546/615 of query aligns to 5:261/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G279), T15 (≠ G281), G16 (= G282), S17 (= S283), F18 (≠ I284), R40 (≠ L305), D41 (≠ S306), K44 (≠ Q315), D63 (≠ S334), V64 (= V335), A84 (= A357), A85 (= A358), K87 (= K360), S126 (= S399), Y137 (≠ M410), K141 (= K414), Y167 (≠ F438), G168 (= G439), V170 (= V441), S173 (= S444), R174 (≠ S445)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K360), D128 (= D401), K129 (= K402), N169 (= N440), G175 (= G446), S176 (= S447), V177 (= V448), P193 (≠ T463), I194 (≠ V464), M199 (≠ V469), R201 (= R471), M235 (≠ I506), R254 (= R539), E257 (= E542)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
31% identity, 45% coverage: 271:546/615 of query aligns to 5:261/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G279), T15 (≠ G281), G16 (= G282), S17 (= S283), F18 (≠ I284), S39 (≠ E304), R40 (≠ L305), D41 (≠ S306), K44 (≠ Q315), D63 (≠ S334), V64 (= V335), A83 (= A356), A84 (= A357), A85 (= A358), K87 (= K360), T102 (≠ N375), L125 (≠ I398), S126 (= S399), T127 (≠ S400), Y137 (≠ M410), K141 (= K414), Y167 (≠ F438), G168 (= G439), V170 (= V441), S173 (= S444), R174 (≠ S445)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K360), T127 (≠ S400), D128 (= D401), K129 (= K402), Y137 (≠ M410), N169 (= N440), S176 (= S447), V177 (= V448), P193 (≠ T463), T195 (= T465), M199 (≠ V469), R201 (= R471), M235 (≠ I506), R254 (= R539), E257 (= E542)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
27% identity, 37% coverage: 270:497/615 of query aligns to 1:198/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G279), T12 (≠ G281), G13 (= G282), S14 (= S283), F15 (≠ I284), S35 (≠ E304), R36 (≠ L305), D37 (≠ S306), K40 (≠ A309), D59 (≠ S334), V60 (= V335), A80 (= A357), A81 (= A358), K83 (= K360), L121 (≠ I398), T123 (≠ S400), K137 (= K414), Y163 (≠ F438), G164 (= G439)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
28% identity, 40% coverage: 276:519/615 of query aligns to 34:278/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G282), S41 (= S283), I42 (= I284), D62 (≠ E304), I63 (≠ L305), D92 (≠ V331), I93 (≠ L332), L114 (≠ A356), S115 (≠ A357), A116 (= A358), K118 (= K360), V158 (≠ I398), D161 (= D401), K174 (= K414), V198 (= V441), S201 (= S444)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
27% identity, 36% coverage: 276:496/615 of query aligns to 32:236/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G282), S39 (= S283), I40 (= I284), D60 (≠ E304), I61 (≠ L305), L89 (≠ P330), D90 (≠ V331), I91 (≠ L332), L112 (≠ A356), S113 (≠ A357), A114 (= A358), K116 (= K360), D159 (= D401), K172 (= K414), N195 (= N440), V196 (= V441), S199 (= S444)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
24% identity, 45% coverage: 271:548/615 of query aligns to 4:245/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G279), S14 (≠ G281), G15 (= G282), S16 (= S283), L17 (≠ I284), R36 (≠ L305), D37 (≠ S306), D59 (≠ S334), I60 (≠ V335), A81 (= A356), A82 (= A357), A83 (= A358), K85 (= K360), V128 (≠ I398), Y140 (≠ M410), K144 (= K414), Y168 (≠ F438), G169 (= G439), V171 (= V441)
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 41% coverage: 269:518/615 of query aligns to 5:272/667 of Q9LPG6
- G18 (= G282) mutation to A: Abolishes dehydratase activity.
- K36 (= K299) mutation to A: Reduces dehydratase activity.
- D96 (≠ P363) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K414) mutation to A: Abolishes dehydratase activity.
- G193 (= G443) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
23% identity, 45% coverage: 275:551/615 of query aligns to 3:300/309 of 4zrnA
- active site: T117 (≠ S400), G119 (≠ K402), A120 (= A403), Y143 (≠ M410), K147 (= K414), Y181 (vs. gap), G185 (≠ S447)
- binding nicotinamide-adenine-dinucleotide: G7 (= G279), G10 (= G282), F11 (≠ S283), I12 (= I284), D31 (≠ Y303), N32 (≠ E304), S34 (= S306), S35 (≠ E307), G36 (≠ Q319), S51 (= S334), I52 (≠ V335), L73 (≠ A356), A74 (= A357), A75 (= A358), T92 (≠ N375), S115 (≠ I398), S116 (= S399), Y143 (≠ M410), K147 (= K414), Y170 (≠ F438), V173 (= V441)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S400), G119 (≠ K402), A120 (= A403), Y143 (≠ M410), N172 (= N440), G185 (≠ S447), V186 (= V448), H201 (≠ T463), F203 (≠ T465), Y208 (≠ V469), R210 (= R471), V244 (≠ I506), R267 (vs. gap), D270 (= D530)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
27% identity, 28% coverage: 275:444/615 of query aligns to 4:181/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G279), G11 (= G282), Y12 (≠ S283), I13 (= I284), D32 (≠ Y303), N33 (≠ E304), S35 (= S306), G37 (vs. gap), D57 (≠ Q320), L58 (≠ V321), F79 (≠ A356), A80 (= A357), I83 (≠ K360), N98 (= N375), Y147 (≠ M410), K151 (= K414), Y175 (≠ F438), N177 (= N440), V178 (= V441)
Query Sequence
>GFF3914 FitnessBrowser__Phaeo:GFF3914
MISGAISGHIKRPPQVYAVTGDWKWGRPGMFNLISALSRKQKSYIFLTIDLGLIPLALLL
TFLVQPLPGSALATLAAMLPVLPYVLAVSAGVALWLGLPPGTHVVFATTYFLCLLAARAV
LYQVVVAIYRRAQPRCRVLIYGAGTTGAQLAQALKAHDGIDPVAFVDDNTSLQGVTLVGL
PVFPPARIAEIAEARQIKRVLLAMPSQSQPKQAQIIQRLQRMQLEVQALPSFAQLIGEEA
LVDKLTPVAPQNFLGRATRDVPLQEASGSYQDRVVLVSGAGGSIGSELCRQVLACRPRKL
VLYELSELALYTIHQELEQQVEGTGITLVPVLGSVTDPRQVRMVLAHHGVQVVLHAAAYK
HVPLVEANPLPGLANNVFGTQTLARAAARSGVERFILISSDKAVRPTNVMGASKRMAELV
VQDLSTRNPGTVFTMVRFGNVLGSSGSVVPLFQEQISRGGPVTVTDPRVKRYFMTIREAV
QLVLQAGAEALGGEVFVLDMGEPISILQLARQVIESAGYSVRDEDHPDGDIAIDIIGLRP
GEKMQEELTLSSDLITTRHQKIFCAREAVLSEIEVATLIRGLRQAVAAGDEGVARALIKR
WVEGYRAPEEDRKTS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory