Comparing GFF3998 FitnessBrowser__psRCH2:GFF3998 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
73% identity, 98% coverage: 1:625/641 of query aligns to 1:624/635 of Q88JU3
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
72% identity, 98% coverage: 1:625/641 of query aligns to 3:621/624 of 5hmqD
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
34% identity, 52% coverage: 296:629/641 of query aligns to 9:348/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
34% identity, 51% coverage: 296:625/641 of query aligns to 12:339/341 of 7xntA
7x8eA Crystal structure of pfhppd-y13287 complex
35% identity, 52% coverage: 296:629/641 of query aligns to 11:340/341 of 7x8eA
7xntC Crystal structure of pfhppd-y13161 complex
35% identity, 50% coverage: 296:615/641 of query aligns to 11:313/320 of 7xntC
Sites not aligning to the query:
2r5vA Hydroxymandelate synthase crystal structure (see paper)
31% identity, 50% coverage: 297:616/641 of query aligns to 5:333/346 of 2r5vA
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
31% identity, 50% coverage: 297:616/641 of query aligns to 6:335/357 of O52791
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
29% identity, 47% coverage: 324:626/641 of query aligns to 39:341/343 of 3zgjB
1t47A Structure of fe2-hppd bound to ntbc (see paper)
27% identity, 45% coverage: 341:629/641 of query aligns to 62:362/362 of 1t47A
7yvvA Acmp1, r-4-hydroxymandelate synthase
28% identity, 42% coverage: 355:626/641 of query aligns to 66:333/335 of 7yvvA
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
26% identity, 28% coverage: 437:615/641 of query aligns to 176:363/393 of Q02110
Sites not aligning to the query:
5yy6A Crystal structure of arabidopsis thaliana hppd truncated mutant complexed with benquitrione (see paper)
26% identity, 42% coverage: 338:605/641 of query aligns to 76:345/371 of 5yy6A
Sites not aligning to the query:
P93836 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 42% coverage: 338:605/641 of query aligns to 110:399/445 of P93836
1sp9A 4-hydroxyphenylpyruvate dioxygenase (see paper)
26% identity, 42% coverage: 334:605/641 of query aligns to 57:333/362 of 1sp9A
1tfzA Structural basis for herbicidal inhibitor selectivity revealed by comparison of crystal structures of plant and mammalian 4- hydroxyphenylpyruvate dioxygenases (see paper)
26% identity, 42% coverage: 338:605/641 of query aligns to 75:343/364 of 1tfzA
Sites not aligning to the query:
8hx4A Crystal structure of athppd-y18549 complex
26% identity, 42% coverage: 338:605/641 of query aligns to 76:350/382 of 8hx4A
Sites not aligning to the query:
8hxgA Crystal structure of athppd-y14116 complex
26% identity, 42% coverage: 338:605/641 of query aligns to 76:350/380 of 8hxgA
Sites not aligning to the query:
7x67A Crystal structure of athppd-y18406 complex (see paper)
26% identity, 42% coverage: 338:605/641 of query aligns to 76:350/380 of 7x67A
Sites not aligning to the query:
7cqrA Complex structure of hppd with y16550
26% identity, 42% coverage: 338:605/641 of query aligns to 76:350/380 of 7cqrA
Sites not aligning to the query:
>GFF3998 FitnessBrowser__psRCH2:GFF3998
MKRSIATVSLSGTLPEKLEAAAAAGFDGIELFENDLLYHSGSPLDVRRRCEELGLAVTLF
QPFRDFEGCPRERLQRNLDRAERKFDLMQELGAELMLLCSNVQADALGDRETLLGDLGLI
AERAGARGLRVGYEALAWGRHVKTWRDVWTLVQQVDHPALGVILDSFHTLALGDDPSGIV
EIPGERIFFVQLADAPVLAMDVLEWSRHFRCFPGQGEFDLAGFLAPVLQAGYSGPLSLEV
FNDGFRAAPPRGIAADGLRALRHLEEKTGQRLSASAPSAAVVPSLFTAPAAPRYEGIDFL
EFAVDEPHAVRLGSWLQQLGFAHVGQHRSKDVQLFRQGEINIVLNAEPYSFAHNYFEAHG
PSVCAMALKIDDEASALARACAFGGQPYRGLIGPNERQIPAVRAPDGGLIYLLESGAPGQ
SNYDIDFRLHAVTPAGAGLQRIDHMATALPAESLASWVLFYRSLFDFEADDELLLPDPYG
LMKCRAMRSPCGRVRLPLNTSQDRDTVIAQALSSYRGAGVHHVAFACDDIFAEVARAQAA
GVPLLQIPRNYYDDLAARFDFDDSLLAELARYNVLYDRDAEGGELFHVYTEPFEGRFFFE
ILQRCNGYAGYGTPNVAVRLAAMAKQCRRTAPAATALASAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory