Comparing GFF4026 FitnessBrowser__psRCH2:GFF4026 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
46% identity, 85% coverage: 41:353/367 of query aligns to 1:314/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
43% identity, 87% coverage: 41:361/367 of query aligns to 2:323/329 of 4petA
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
42% identity, 87% coverage: 45:363/367 of query aligns to 7:325/330 of 7ug8B
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
39% identity, 88% coverage: 44:366/367 of query aligns to 33:352/365 of Q3J1R2
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
39% identity, 89% coverage: 40:366/367 of query aligns to 1:324/337 of 2hzlB
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
38% identity, 89% coverage: 42:366/367 of query aligns to 4:328/344 of 4yicA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
31% identity, 75% coverage: 40:315/367 of query aligns to 31:311/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
31% identity, 75% coverage: 41:315/367 of query aligns to 1:280/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
31% identity, 75% coverage: 41:315/367 of query aligns to 1:280/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
27% identity, 77% coverage: 65:348/367 of query aligns to 22:306/315 of 4pe3A
7e9yA Crystal structure of elacco1 (see paper)
33% identity, 50% coverage: 41:222/367 of query aligns to 1:182/563 of 7e9yA
Sites not aligning to the query:
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
26% identity, 85% coverage: 42:353/367 of query aligns to 2:308/317 of 4xf5A
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
26% identity, 85% coverage: 42:353/367 of query aligns to 1:307/315 of 4uabA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
24% identity, 75% coverage: 59:334/367 of query aligns to 20:293/310 of 7bcrA
Sites not aligning to the query:
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
24% identity, 75% coverage: 59:334/367 of query aligns to 20:293/310 of 7bcpA
Sites not aligning to the query:
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
24% identity, 75% coverage: 59:334/367 of query aligns to 20:293/310 of 7bcoA
Sites not aligning to the query:
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
24% identity, 75% coverage: 59:334/367 of query aligns to 20:293/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
24% identity, 75% coverage: 59:334/367 of query aligns to 21:294/310 of 7bbrA
Sites not aligning to the query:
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
25% identity, 72% coverage: 46:309/367 of query aligns to 4:265/306 of 4xfeA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
26% identity, 55% coverage: 44:244/367 of query aligns to 5:204/304 of 4x8rA
Sites not aligning to the query:
>GFF4026 FitnessBrowser__psRCH2:GFF4026
MKRRHLFGAAAALLATLGLAGCNDDKKVENAGQQAASEPAKTYTWKMVTAWPKNYPGLGT
AAERLADRVKVMSDGRLTIKVYAAGELVPALEVFDAVSRGTAELGHGAAYYWKGKVPTAQ
FFTSVPFGLSAIEMNAWLSRGEGQKFWEEAYAPFGVKPMVVGNTGMQMGGWYNKEINALG
DLRGLKIRMPGLGGEVLARLGATTVNLPGGEVFTALQTGAIDATDWVSPYNDLAFGLHKA
AKYYYYPGWQEPQAVLELLVNQKAMDTLPEDLQAILTEATRAASRDMMDDYVYNNALALE
QLKQQGVELKRFPDEVLDAMQEQSELVLGELAAQSELNGRIWASMKAFQEQVKPMHEISE
KELYNWR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory