Comparing GFF4121 FitnessBrowser__Marino:GFF4121 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
62% identity, 91% coverage: 30:357/361 of query aligns to 1:328/329 of 4petA
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
61% identity, 91% coverage: 31:357/361 of query aligns to 1:327/331 of 5cm6A
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
37% identity, 88% coverage: 36:351/361 of query aligns to 8:322/330 of 7ug8B
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
35% identity, 89% coverage: 34:354/361 of query aligns to 33:352/365 of Q3J1R2
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
35% identity, 89% coverage: 34:354/361 of query aligns to 5:324/337 of 2hzlB
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
33% identity, 89% coverage: 36:356/361 of query aligns to 8:327/344 of 4yicA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 92% coverage: 13:343/361 of query aligns to 13:348/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
28% identity, 87% coverage: 31:343/361 of query aligns to 1:317/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
28% identity, 87% coverage: 31:343/361 of query aligns to 1:317/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
30% identity, 58% coverage: 52:262/361 of query aligns to 18:230/315 of 4pe3A
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
29% identity, 50% coverage: 33:212/361 of query aligns to 3:182/563 of 7e9yA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
27% identity, 66% coverage: 30:266/361 of query aligns to 1:235/304 of 4x8rA
7nswBBB TRAP dicarboxylate transporter-DctP subunit (see paper)
28% identity, 65% coverage: 30:265/361 of query aligns to 2:238/328 of 7nswBBB
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
26% identity, 51% coverage: 163:345/361 of query aligns to 131:309/317 of 4xf5A
Sites not aligning to the query:
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
26% identity, 51% coverage: 163:345/361 of query aligns to 130:308/315 of 4uabA
Sites not aligning to the query:
7ntdAAA TRAP dicarboxylate transporter-DctP subunit (see paper)
28% identity, 65% coverage: 32:265/361 of query aligns to 2:236/322 of 7ntdAAA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
27% identity, 60% coverage: 50:266/361 of query aligns to 17:232/300 of 4n8yA
Sites not aligning to the query:
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
24% identity, 71% coverage: 16:273/361 of query aligns to 9:265/329 of P44542
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
24% identity, 67% coverage: 32:273/361 of query aligns to 1:241/305 of 2cexB
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
24% identity, 67% coverage: 32:273/361 of query aligns to 2:242/309 of 2v4cA
>GFF4121 FitnessBrowser__Marino:GFF4121
MEANTMTIRKTLLAAMAAAATVFSVSSVAEENYTLRLAQTWGPNSPVLGETVQHMADMAE
TMSDGRLQIRIDPSNKHKAPFGIFDLVRNGQYDMGHTASYYYKGSIPNAMYFTTIPFGLI
APEMYAWFYHGEGMELMQKVYEPYGMLSFPGGNTGNQMGGWFRKEINSLEDLKGLKMRTP
GFAGEVMSELGVAVTNLPPGELYTALERGTVDAVEWVGPALDFQMGFHQIAKYYYSGWQE
PGAEVQFLINKKTWEELPKDLQEILRVSMRTAAYDMYIQSTHQSGVAWDRMKEDYPDVTH
KVFPPEVIDALRSTTNRLLAEAAEKDPLAKEIIDSQRDYLKQVRQWTNISDKAYLNSVAE
D
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory