Comparing GFF4165 FitnessBrowser__WCS417:GFF4165 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
5abpA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
60% identity, 92% coverage: 24:324/326 of query aligns to 2:302/305 of 5abpA
1abfA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
60% identity, 92% coverage: 24:324/326 of query aligns to 2:302/305 of 1abfA
1abeA Novel stereospecificity of the l-arabinose-binding protein (see paper)
60% identity, 92% coverage: 24:324/326 of query aligns to 2:302/305 of 1abeA
4kzkA The structure of the periplasmic l-arabinose binding protein from burkholderia thailandensis
46% identity, 92% coverage: 24:324/326 of query aligns to 1:301/301 of 4kzkA
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
26% identity, 98% coverage: 1:321/326 of query aligns to 1:312/318 of P39325
5kwsA Crystal structure of galactose binding protein from yersinia pestis in the complex with beta d glucose
26% identity, 61% coverage: 63:261/326 of query aligns to 44:240/307 of 5kwsA
Sites not aligning to the query:
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
25% identity, 91% coverage: 26:321/326 of query aligns to 4:290/296 of 2vk2A
>GFF4165 FitnessBrowser__WCS417:GFF4165
MFKKTLGTLALAMAFSSVALAEEVKIGFLVKQAEEPWFQTEWAFAEKAGKDQGFTVIKIA
VPDGEKTLSAIDTLAANGAKGFVICPPDVSLGPAIMAKAKLNNLKVLAVDDRFVDAKGKP
MEDVPYVGLDAYKIGQKQGEAMATEAKHRNWDWKDTYAVINTFDELETGKKRTDGSVEGL
KAAGLPADHILFSAQKTLDVPGSMDATNSALVKLPSGAKNLIIGGMNDSTVLGGVRATES
AGFKAANVIGVGINGTDAIEELKKSDTGFYGSMLLSPDASGYKTASAMFEWVTQGTEPAK
FTALDNVTLITRANFKEELSKIGLWK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory