SitesBLAST
Comparing GFF428 FitnessBrowser__WCS417:GFF428 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07117 Sodium/proline symporter; Proline carrier; Proline permease; Propionate transporter from Escherichia coli (strain K12) (see 4 papers)
76% identity, 99% coverage: 1:491/494 of query aligns to 1:492/502 of P07117
- R257 (= R257) mutation to C: Sodium-independent binding affinity for proline.
- C281 (= C281) mutation to S: Does not affect proline uptake activity. Confers resistance to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- C344 (= C344) mutation to S: Small decrease in proline uptake activity. Confers resistance to N-ethylmaleimide. Exhibits low Na(+)-dependent proline binding.
- C349 (= C349) mutation to S: Does not affect proline uptake activity. Sensitive to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- R376 (= R376) mutation R->E,Q: No change in activity.; mutation to K: Loss of activity.
Q9ET37 Solute carrier family 5 member 4A; SGLT3-a from Mus musculus (Mouse) (see paper)
23% identity, 87% coverage: 12:439/494 of query aligns to 33:494/656 of Q9ET37
- E457 (≠ A406) mutation to Q: Confers sodium-dependent sugar transport activity not found in the wild type protein.
Q9NY91 Probable glucose sensor protein SLC5A4; Solute carrier family 5 member 4 from Homo sapiens (Human) (see paper)
23% identity, 86% coverage: 12:437/494 of query aligns to 33:492/659 of Q9NY91
- E457 (≠ A406) mutation to Q: Confers sugar transport activity not found in the wild-type protein. Increased sensitivity to inhibitor phlorizin.
3dh4A Crystal structure of sodium/sugar symporter with bound galactose from vibrio parahaemolyticus (see paper)
25% identity, 74% coverage: 72:435/494 of query aligns to 43:426/512 of 3dh4A
Sites not aligning to the query:
8j74A Human high-affinity choline transporter cht1 in the hc-3-bound outward-facing open conformation, dimeric state (see paper)
25% identity, 87% coverage: 8:437/494 of query aligns to 6:440/515 of 8j74A
- binding Lauryl Maltose Neopentyl Glycol: F203 (≠ I204), S206 (≠ L207), H207 (≠ A208), I213 (≠ T214), G214 (≠ T215), F215 (= F216), H219 (≠ E220), C326 (≠ F322), P327 (≠ N323)
- binding (2S,2'S)-2,2'-biphenyl-4,4'-diylbis(2-hydroxy-4,4-dimethylmorpholin-4-ium): W60 (≠ D55), Y89 (≠ L82), W139 (≠ F137), L245 (≠ W244), W252 (≠ H253), W404 (≠ V401), Y405 (≠ S402), S408 (≠ W405)
Q8N695 Sodium-coupled monocarboxylate transporter 1; Apical iodide transporter; Electrogenic sodium monocarboxylate cotransporter; Sodium iodide-related cotransporter; Solute carrier family 5 member 8 from Homo sapiens (Human) (see 3 papers)
24% identity, 82% coverage: 33:437/494 of query aligns to 43:449/610 of Q8N695
- V193 (≠ A191) to I: in dbSNP:rs1709189
- F251 (≠ M242) to V: in dbSNP:rs11834933
Sites not aligning to the query:
- 608 T→A: Loss of interaction with PDZK1.
- 608:610 PDZ-binding
- 610 L→A: Loss of interaction with PDZK1.
Q9GZV3 High affinity choline transporter 1; hCHT1; Hemicholinium-3-sensitive choline transporter; CHT; Solute carrier family 5 member 7 from Homo sapiens (Human) (see 5 papers)
25% identity, 87% coverage: 8:437/494 of query aligns to 8:442/580 of Q9GZV3
- D48 (≠ S41) to G: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs886039768
- G65 (= G58) to E: in CMS20; loss of choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs886039765
- I89 (= I80) to V: 40% reduction in choline transmembrane transporter activity; found in 0.06 of Ashkenazi Jews; dbSNP:rs1013940; mutation to A: Decreased choline transmembrane transporter activity, only 20% of wild-type choline uptake activity.
- P105 (≠ R96) to S: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs886039766
- Y111 (≠ A107) to H: in CMS20; no effect on localization at plasma membrane
- Y175 (= Y174) to C: in CMS20; uncertain significance; dbSNP:rs1331713195
- I291 (≠ F291) to T: in CMS20; uncertain significance; dbSNP:rs375397889
- V344 (= V338) to L: in CMS20; uncertain significance
- R361 (≠ E355) to Q: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs147656110
- F418 (≠ G413) to V: in CMS20; uncertain significance
Sites not aligning to the query:
- 446 R → G: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane
- 451 E→Q: Decreased choline transmembrane transporter activity, only 5% of wild-type choline uptake activity.
- 527:532 Dileucine-like motif
- 530 I→A: No change in protein internalization. No change in choline transmembrane transporter activity.
- 531 L→A: Loss of protein internalization to vesicular structures in neurons. Increased choline transmembrane transporter activity.
- 531:532 LV→AA: Decreased protein internalization; when associated with V-538. Increased choline transmembrane transporter activity; when associated with V-538.
- 532 V→A: Decreased protein internalization. Increased choline transmembrane transporter activity.
- 538 K→V: Decreased protein internalization; when associated with 531-L-V-532. Increased choline transmembrane transporter activity; when associated with 531-L-V-532.
7wmvA Structure of human sglt1-map17 complex bound with lx2761 (see paper)
24% identity, 85% coverage: 12:431/494 of query aligns to 16:469/602 of 7wmvA
- binding N-[2-(dimethylamino)ethyl]-2-methyl-2-[4-[4-[[2-methyl-5-[(2S,3R,4R,5S,6R)-6-methylsulfanyl-3,4,5-tris(oxidanyl)oxan-2-yl]phenyl]methyl]phenyl]butanoylamino]propanamide: N61 (≠ D55), H66 (≠ L60), L70 (= L64), I81 (= I80), F84 (vs. gap), L257 (≠ M242), M266 (≠ Q251), L269 (≠ I254), T270 (≠ L255), Y273 (≠ F258), W274 (≠ M259), F436 (≠ L398), D437 (≠ G399), Q440 (≠ S402)
Sites not aligning to the query:
P13866 Sodium/glucose cotransporter 1; Na(+)/glucose cotransporter 1; High affinity sodium-glucose cotransporter; Solute carrier family 5 member 1 from Homo sapiens (Human) (see 6 papers)
24% identity, 85% coverage: 12:431/494 of query aligns to 33:486/664 of P13866
- N51 (= N30) to S: in GGM; slightly decreased activity; dbSNP:rs17683011
- W67 (≠ S44) mutation to A: Strong reduction in D-glucose transporter activity.
- S77 (= S54) mutation to A: Loss of activity.
- H83 (≠ L60) mutation to L: Acquires D-mannose, D-fructose and L-sorbose transporter activity; when associated with A-287 and C-290.; mutation to Q: Loss of D-glucose transporter activity.
- R135 (= R117) to W: in GGM; loss of activity
- S159 (≠ C141) to P: in GGM; loss of activity
- A166 (= A149) to T: in GGM; about 90% reduction in activity
- D204 (= D187) mutation to A: Loss of activity.
- N248 (= N232) modified: carbohydrate, N-linked (GlcNAc...) asparagine; mutation to Q: Loss of N-glycosylation.
- C255 (vs. gap) modified: Disulfide link with 511
- W276 (= W244) to L: in GGM; about 95% reduction in activity
- T287 (≠ L255) mutation to A: Acquires D-mannose, D-fructose and L-sorbose transporter activity; when associated with L-83 and C-290.; mutation to N: Loss of D-glucose transporter activity. Has strict selectivity for D-galactose.; mutation T->S,A: Has normal D-glucose and D-galactose transporter activity.
- Y290 (≠ F258) mutation to C: Loss of D-galactose transporter activity. Has strict selectivity for D-glucose. Acquires D-mannose, D-fructose and L-sorbose transporter activity; when associated with A-287 and L-83.
- W291 (≠ M259) mutation to A: Loss of D-glucose transporter activity.
- C292 (≠ A260) to Y: in GGM; loss of activity; mutation to A: Has no effect on water permeability.
- Q295 (≠ S263) to R: in GGM; loss of activity
- R300 (= R271) to S: in GGM; loss of activity
- A304 (≠ M275) to V: in GGM; impairs trafficking to the plasma membrane
- K321 (≠ G292) mutation to Q: Acquires D-mannose and D-allose transporter activity comparable to glucose and galactose.
- C345 (≠ G304) modified: Disulfide link with 351
- C351 (≠ H310) modified: Disulfide link with 345
- C355 (vs. gap) modified: Disulfide link with 361
- C361 (vs. gap) modified: Disulfide link with 355
- N363 (vs. gap) mutation to A: Loss of water permeation.
- L369 (= L317) to S: in GGM; loss of activity
- R379 (≠ A327) to Q: in GGM; loss of activity
- A388 (= A336) to V: in GGM; loss of activity
- S396 (≠ C344) mutation to A: Loss of activity.
- F405 (≠ L353) to S: in GGM; loss of activity
- A411 (≠ K359) to T: in GGM; slightly decreased activity; dbSNP:rs17683430
- G426 (= G375) to R: in GGM; loss of activity
- Q451 (≠ R396) mutation to A: Strong reduction in water permeation.
- L452 (≠ V397) mutation to A: Loss of water permeation.
- D454 (≠ G399) mutation to A: Has no effect on water permeation.
- Q457 (≠ S402) mutation to A: Loss of D-glucose transporter activity.; mutation to C: Strong reduction in D-glucose transporter activity.
- T460 (≠ W405) mutation to A: Loss of D-glucose transporter activity.
- V470 (= V415) to N: in GGM; about 90% reduction in activity; requires 2 nucleotide substitutions
Sites not aligning to the query:
- 191:664 natural variant: Missing (in GGM; loss of activity)
- 379:664 natural variant: Missing (in GGM; loss of activity)
- 499 R → H: in GGM; impairs trafficking to the plasma membrane; decreases the sugar affinity
- 511 modified: Disulfide link with 255
- 517 modified: Disulfide link with 522
- 522 modified: Disulfide link with 517
- 615 H → Q: in GGM; slightly decreased activity
- 641 W→A: Slightly reduced D-glucose transporter activity.
- 660:661 HA→WG: Loss of D-glucose transporter activity.
Q92911 Sodium/iodide cotransporter; Na(+)/I(-) cotransporter; Natrium iodide transporter; Sodium-iodide symporter; Na(+)/I(-) symporter; Solute carrier family 5 member 5 from Homo sapiens (Human) (see 3 papers)
22% identity, 74% coverage: 24:391/494 of query aligns to 36:403/643 of Q92911
- A102 (≠ W90) natural variant: A -> P
- H226 (≠ K222) mutation H->A,D,E,K: Significant loss of iodide transport activity but no effect on its localization to the cell membrane.
- D237 (= D228) mutation to A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization.
- Y242 (≠ T233) Required for homodimerization; mutation to A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471. Loss of iodide transport activity; when associated with F-535.
- T243 (= T234) Required for homodimerization; mutation to A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471.
Sites not aligning to the query:
- 471 Required for homodimerization; Q→A: No effect on localization to the cell membrane, iodide transport activity and homodimerization. Significant loss of homodimerization; when associated with A-242 or A243.
- 525 A→F: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Loss of iodide transport activity; when associated with A-242.
- 536 T → Q: requires 2 nucleotide substitutions
- 556 S → Q: requires 2 nucleotide substitutions
7slaA Cryoem structure of sglt1 at 3.15 angstrom resolution (see paper)
22% identity, 74% coverage: 66:430/494 of query aligns to 49:454/585 of 7slaA
Sites not aligning to the query:
7sl8A Cryoem structure of sglt1 at 3.4 a resolution (see paper)
22% identity, 74% coverage: 66:430/494 of query aligns to 48:453/582 of 7sl8A
Sites not aligning to the query:
7sl9A Cryoem structure of smct1 (see paper)
24% identity, 80% coverage: 41:437/494 of query aligns to 30:428/497 of 7sl9A
P11170 Sodium/glucose cotransporter 1; Na(+)/glucose cotransporter 1; High affinity sodium-glucose cotransporter; Solute carrier family 5 member 1 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
31% identity, 38% coverage: 12:201/494 of query aligns to 33:219/662 of P11170
Sites not aligning to the query:
- 255 modified: Disulfide link with 608
- 457 Q→W: Drasticly decreased affinity for glucose and phlorizin.
- 460 T→W: Decreased affinity for glucose and phlorizin.
- 608 modified: Disulfide link with 255
P31639 Sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2; Low affinity sodium-glucose cotransporter; Solute carrier family 5 member 2 from Homo sapiens (Human) (see paper)
24% identity, 76% coverage: 3:377/494 of query aligns to 20:428/672 of P31639
- V95 (≠ E75) mutation to A: Strong reduction in D-glucose transporter activity. Confers partial resistance to empagliflozin inhibition.
- F98 (vs. gap) mutation to A: Slightly decreases D-glucose transporter activity. Abolishes the binding to inhibitor, empagliflozin.
- V157 (≠ S143) mutation to A: Decreases D-glucose transporter activity.
- L283 (≠ I238) mutation to M: Strong reduction in D-glucose transporter activity. Confers partial resistance to empagliflozin inhibition.
Sites not aligning to the query:
- 453 F→A: Slightly decreases D-glucose transporter activity. Greatly reduces the binding to inhibitor, empagliflozin.
8hdhA Structure of human sglt2-map17 complex with canagliflozin (see paper)
24% identity, 76% coverage: 4:377/494 of query aligns to 1:408/586 of 8hdhA
- binding (2~{S},3~{R},4~{R},5~{S},6~{R})-2-[3-[[5-(4-fluorophenyl)thiophen-2-yl]methyl]-4-methyl-phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (≠ D55), G59 (≠ W59), H60 (≠ L60), G63 (= G63), L64 (= L64), F78 (vs. gap), E79 (vs. gap), S267 (≠ M242), W271 (≠ F249)
- binding sodium ion: A53 (= A53), S54 (= S54), I56 (≠ M56), G57 (≠ S57), A369 (= A337), S372 (= S340), S373 (≠ T341)
Sites not aligning to the query:
- binding (2~{S},3~{R},4~{R},5~{S},6~{R})-2-[3-[[5-(4-fluorophenyl)thiophen-2-yl]methyl]-4-methyl-phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: 433, 434, 437, 506
- binding : 575, 579, 580, 583, 584
8hb0A Structure of human sglt2-map17 complex with ta1887 (see paper)
24% identity, 76% coverage: 4:377/494 of query aligns to 1:408/586 of 8hb0A
- binding (2R,3R,4S,5S,6R)-2-[3-[(4-cyclopropylphenyl)methyl]-4-fluoranyl-indol-1-yl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (≠ D55), H60 (≠ L60), G63 (= G63), L64 (= L64), T67 (≠ A67), V75 (≠ E75), F78 (vs. gap), E79 (vs. gap), V137 (≠ S143), V266 (≠ L241), S267 (≠ M242), W271 (≠ F249)
- binding sodium ion: A53 (= A53), I56 (≠ M56), G57 (≠ S57), A369 (= A337), S372 (= S340), S373 (≠ T341)
Sites not aligning to the query:
- binding (2R,3R,4S,5S,6R)-2-[3-[(4-cyclopropylphenyl)methyl]-4-fluoranyl-indol-1-yl]-6-(hydroxymethyl)oxane-3,4,5-triol: 433, 437
- binding : 575, 576, 579, 580, 583, 584
8hg7A Structure of human sglt2-map17 complex with sotagliflozin (see paper)
24% identity, 76% coverage: 4:377/494 of query aligns to 1:408/590 of 8hg7A
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-methylsulfanyl-oxane-3,4,5-triol: N55 (≠ D55), G59 (≠ W59), H60 (≠ L60), G63 (= G63), L64 (= L64), E79 (vs. gap), V266 (≠ L241), S267 (≠ M242), Y270 (= Y248), W271 (≠ F249), K301 (≠ S274)
- binding sodium ion: A53 (= A53), S54 (= S54), I56 (≠ M56), G57 (≠ S57), A369 (= A337), S372 (= S340), S373 (≠ T341)
Sites not aligning to the query:
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-methylsulfanyl-oxane-3,4,5-triol: 433, 437
- binding : 579, 583, 584, 587, 588
8hezA Structure of human sglt2-map17 complex with dapagliflozin (see paper)
24% identity, 76% coverage: 4:377/494 of query aligns to 1:408/582 of 8hezA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (≠ D55), G59 (≠ W59), H60 (≠ L60), G63 (= G63), L64 (= L64), T67 (≠ A67), F78 (vs. gap), E79 (vs. gap), V266 (≠ L241), S267 (≠ M242), W271 (≠ F249), K301 (≠ S274)
- binding sodium ion: A53 (= A53), I56 (≠ M56), G57 (≠ S57), A369 (= A337), S372 (= S340), S373 (≠ T341)
Sites not aligning to the query:
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: 433, 437
- binding : 568, 571, 572, 575, 576, 579, 580
7vsiA Structure of human sglt2-map17 complex bound with empagliflozin (see paper)
24% identity, 76% coverage: 4:377/494 of query aligns to 1:408/586 of 7vsiA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (≠ D55), H60 (≠ L60), G63 (= G63), L64 (= L64), V75 (≠ E75), F78 (vs. gap), E79 (vs. gap), V266 (≠ L241), S267 (≠ M242), Y270 (= Y248)
Sites not aligning to the query:
Query Sequence
>GFF428 FitnessBrowser__WCS417:GFF428
MSVSNPTLITFVIYIAAMVLIGFMAYRSTNNLSDYILGGRSLGSVVTALSAGASDMSGWL
LMGLPGAIYMSGLSESWIAIGLIVGAYLNWLFVAGRLRVQTEHNGDALTLPDYFSSRFED
KSGLLRIISAVVILVFFTIYCASGIVAGARLFESTFGMSYETALWAGAAATIAYTFVGGF
LAVSWTDTVQATLMIFALILTPIIVLLATGGVDTTFLAIEAKDPTNFDMLKNTTFIGIIS
LMGWGLGYFGQPHILARFMAADSVKSIAKARRISMTWMILCLGGTVAVGFFGIAYFSAHP
EVAGPVNENHERVFIELAKLLFNPWIAGVLLSAILAAVMSTLSCQLLVCSSALTEDFYKT
FLRKNASQVELVWVGRLMVLLVALIAIAMAANPENRVLGLVSYAWAGFGAAFGPVVLISV
IWKGMTRNGALAGILVGAITVIVWKHFELLGLYEIIPGFIFASLAIYFVSKLGAPTAGMV
ERFDAAEKDYNLNK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory