SitesBLAST
Comparing GFF4297 FitnessBrowser__WCS417:GFF4297 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7CRQ0 Uronate dehydrogenase; D-galacturonate dehydrogenase; D-glucuronate dehydrogenase; Hexuronate dehydrogenase; EC 1.1.1.203 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
35% identity, 95% coverage: 6:237/245 of query aligns to 4:230/265 of Q7CRQ0
- Y134 (= Y136) mutation to A: 0.1% of wild-type activity.
3rfvA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens complexed with nadh and product (see paper)
35% identity, 95% coverage: 6:237/245 of query aligns to 5:231/265 of 3rfvA
- binding D-galactaro-1,5-lactone: S74 (≠ H75), S110 (= S111), N111 (≠ A112), H112 (≠ Q113), Y135 (= Y136), S164 (≠ A165), R173 (= R178)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G12 (= G13), Q13 (≠ R14), L14 (≠ I15), D33 (≠ R34), L34 (≠ I35), D50 (= D50), L51 (= L51), L70 (= L70), G71 (≠ S71), G72 (= G72), S74 (≠ H75), A108 (= A109), S110 (= S111), Y135 (= Y136), K139 (= K140), I162 (= I163), S164 (≠ A165), C165 (≠ F166)
Sites not aligning to the query:
3rfxA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with NAD (see paper)
35% identity, 95% coverage: 6:237/245 of query aligns to 5:231/265 of 3rfxA
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
31% identity, 74% coverage: 6:187/245 of query aligns to 3:180/328 of 4id9B
- active site: S107 (= S111), Y133 (= Y136), K137 (= K140)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), R11 (= R14), V12 (≠ I15), D31 (≠ R34), L32 (≠ I35), S45 (≠ D50), L46 (= L51), L65 (= L70), A67 (≠ G72), V82 (≠ N86), Y133 (= Y136), K137 (= K140), F160 (= F168), S161 (≠ P169), H162 (≠ E170), T163 (= T171)
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
31% identity, 74% coverage: 6:187/245 of query aligns to 2:179/321 of 4id9A
- active site: S106 (= S111), Y132 (= Y136), K136 (= K140)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), R10 (= R14), V11 (≠ I15), D30 (≠ R34), L31 (≠ I35), R32 (≠ A36), S44 (≠ D50), L45 (= L51), L64 (= L70), A66 (≠ G72), V81 (≠ N86), S106 (= S111), Y132 (= Y136), K136 (= K140), F159 (= F168), H161 (≠ E170), T162 (= T171)
Sites not aligning to the query:
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
31% identity, 58% coverage: 6:147/245 of query aligns to 4:163/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (≠ R14), I13 (= I15), D32 (= D33), N33 (≠ R34), N36 (vs. gap), D62 (= D50), L63 (= L51), F84 (≠ L70), A85 (≠ S71), G86 (= G72), K88 (≠ P74), N103 (= N86), S126 (≠ A109), S128 (= S111), Y152 (= Y136), K156 (= K140)
- binding uridine-5'-diphosphate-glucose: S128 (= S111), A129 (= A112)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 180, 183
- binding uridine-5'-diphosphate-glucose: 181, 182, 202, 203, 219, 220, 221, 234, 236, 275, 298, 301
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
31% identity, 58% coverage: 6:147/245 of query aligns to 4:163/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (≠ R14), I13 (= I15), D32 (= D33), N33 (≠ R34), N36 (vs. gap), D62 (= D50), L63 (= L51), F84 (≠ L70), A85 (≠ S71), G86 (= G72), K88 (≠ P74), N103 (= N86), S126 (≠ A109), S128 (= S111), Y152 (= Y136), K156 (= K140)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 180, 183
- binding uridine-diphosphate-n-acetylglucosamine: 182, 202, 203, 219, 221, 234, 236, 275, 298, 301
3eheA Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
31% identity, 60% coverage: 6:151/245 of query aligns to 2:150/290 of 3eheA
- active site: T111 (≠ S111), S112 (≠ A112), T113 (= T114), Y135 (= Y136), K139 (= K140)
- binding nicotinamide-adenine-dinucleotide: G6 (= G10), G9 (= G13), F10 (≠ R14), I11 (= I15), D29 (= D33), N30 (≠ R34), L31 (≠ I35), S32 (≠ A36), S33 (vs. gap), G34 (vs. gap), D49 (= D50), L50 (= L51), I68 (≠ L70), A69 (≠ S71), A70 (≠ G72), T109 (≠ A109), Y135 (= Y136), K139 (= K140)
Sites not aligning to the query:
7eprB Partial consensus l-threonine 3-dehydrogenase (c-change) (see paper)
31% identity, 64% coverage: 5:162/245 of query aligns to 3:166/310 of 7eprB
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Q12 (≠ R14), I13 (= I15), D34 (= D38), I35 (≠ F39), R36 (≠ D40), D50 (= D50), A51 (≠ L51), L72 (= L70), A73 (≠ S71), A74 (≠ G72), L90 (≠ I88), P113 (≠ S110), Y140 (= Y136), K144 (= K140)
Sites not aligning to the query:
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
30% identity, 64% coverage: 6:162/245 of query aligns to 2:163/315 of 3a1nA
- active site: T112 (≠ S111), Y137 (= Y136), K141 (= K140)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ C12), G9 (= G13), Q10 (≠ R14), I11 (= I15), D32 (= D38), I33 (≠ F39), L46 (≠ A49), D47 (= D50), L69 (= L70), A70 (≠ S71), G71 (= G72), L73 (≠ P74), S111 (= S110), Y137 (= Y136), K141 (= K140)
Sites not aligning to the query:
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
30% identity, 64% coverage: 6:162/245 of query aligns to 2:163/311 of 3a4vA
- active site: T112 (≠ S111), Y137 (= Y136), K141 (= K140)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ C12), G9 (= G13), Q10 (≠ R14), I11 (= I15), D32 (= D38), I33 (≠ F39), L46 (≠ A49), D47 (= D50), V48 (≠ L51), L69 (= L70), A70 (≠ S71), G71 (= G72), L73 (≠ P74), P110 (≠ A109), S111 (= S110), T112 (≠ S111), Y137 (= Y136), K141 (= K140)
- binding pyruvic acid: S74 (≠ H75), Y137 (= Y136)
Sites not aligning to the query:
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
28% identity, 65% coverage: 4:162/245 of query aligns to 1:175/314 of 6zldA
- active site: T126 (≠ S111), S127 (≠ A112), S128 (≠ Q113), Y149 (= Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (≠ R14), I12 (= I15), D32 (= D33), H33 (≠ R34), F34 (vs. gap), I35 (= I35), K43 (vs. gap), D62 (= D50), I63 (≠ L51), L81 (= L70), A82 (≠ S71), A83 (≠ G72), I124 (≠ A109), T126 (≠ S111), K153 (= K140)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (= P74), R88 (≠ S77), T126 (≠ S111), S127 (≠ A112), S128 (≠ Q113), Y149 (= Y136)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 176, 178, 185, 188
- binding uridine-5'-diphosphate-glucuronic acid: 177, 178, 185, 188, 189, 192, 204, 206, 211, 213, 250, 276
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
28% identity, 65% coverage: 4:162/245 of query aligns to 1:175/314 of 6zl6A
- active site: T126 (≠ S111), S127 (≠ A112), S128 (≠ Q113), Y149 (= Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (≠ R14), I12 (= I15), D32 (= D33), H33 (≠ R34), F34 (vs. gap), I35 (= I35), K43 (vs. gap), D62 (= D50), I63 (≠ L51), L81 (= L70), A82 (≠ S71), A83 (≠ G72), I124 (≠ A109), T126 (≠ S111), K153 (= K140)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 176, 178, 179, 185, 188
- binding uridine-5'-diphosphate: 178, 189, 192, 204, 206, 211, 213, 250, 276
6kv9A Moee5 in complex with udp-glucuronic acid and NAD (see paper)
33% identity, 67% coverage: 5:168/245 of query aligns to 2:162/299 of 6kv9A
- active site: S110 (= S111), S111 (≠ A112), S112 (≠ Q113), Y133 (= Y136), K137 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (≠ R14), I12 (= I15), D31 (≠ R34), R32 (≠ I35), R33 (≠ A36), D47 (= D50), L48 (= L51), L66 (= L70), A67 (≠ S71), A68 (≠ G72), P70 (= P74), C85 (≠ N86), A108 (= A109), S109 (= S110), K137 (= K140), F162 (= F168)
- binding uridine-5'-diphosphate-glucuronic acid: P70 (= P74), R73 (≠ S77), S110 (= S111), S111 (≠ A112), Y133 (= Y136)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 164, 165, 171, 174
- binding uridine-5'-diphosphate-glucuronic acid: 164, 171, 174, 175, 178, 190, 191, 192, 197, 199, 235, 261
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
28% identity, 65% coverage: 4:162/245 of query aligns to 1:175/321 of 6zllA
- active site: T126 (≠ S111), S127 (≠ A112), S128 (≠ Q113), Y149 (= Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (≠ R14), I12 (= I15), D32 (= D33), H33 (≠ R34), F34 (vs. gap), I35 (= I35), K43 (vs. gap), D62 (= D50), I63 (≠ L51), L81 (= L70), A82 (≠ S71), A83 (≠ G72), I124 (≠ A109), T126 (≠ S111), Y149 (= Y136), K153 (= K140)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (= P74), V87 (≠ A76), R88 (≠ S77), T126 (≠ S111), S127 (≠ A112), Y149 (= Y136)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 176, 179, 185, 188
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: 178, 185, 189, 192, 204, 206, 211, 213, 250, 276
5z75A Artificial l-threonine 3-dehydrogenase designed by ancestral sequence reconstruction. (see paper)
28% identity, 65% coverage: 4:162/245 of query aligns to 3:166/306 of 5z75A
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), C11 (= C12), G12 (= G13), Q13 (≠ R14), I14 (= I15), D35 (= D33), I36 (≠ R34), L49 (≠ A49), V51 (≠ L51), L72 (= L70), A73 (≠ S71), L76 (≠ P74), P113 (≠ A109), S115 (= S111), Y140 (= Y136), K144 (= K140)
Sites not aligning to the query:
3a9wA Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
30% identity, 64% coverage: 6:162/245 of query aligns to 2:163/315 of 3a9wA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ C12), G9 (= G13), Q10 (≠ R14), I11 (= I15), D32 (= D38), I33 (≠ F39), L46 (≠ A49), D47 (= D50), V48 (≠ L51), L69 (= L70), A70 (≠ S71), L73 (≠ P74), V87 (vs. gap), P110 (≠ A109), S111 (= S110), K141 (= K140)
- binding threonine: S74 (≠ H75), T112 (≠ S111), F137 (≠ Y136)
Sites not aligning to the query:
3ajrA Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
30% identity, 64% coverage: 6:162/245 of query aligns to 2:163/314 of 3ajrA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ C12), G9 (= G13), Q10 (≠ R14), I11 (= I15), D32 (= D38), I33 (≠ F39), L46 (≠ A49), D47 (= D50), V48 (≠ L51), L69 (= L70), A70 (≠ S71), G71 (= G72), L73 (≠ P74), P110 (≠ A109), S111 (= S110), T112 (≠ S111), F137 (≠ Y136), K141 (= K140)
- binding (3R)-3-hydroxy-L-norvaline: S74 (≠ H75), T112 (≠ S111), I113 (≠ A112), F137 (≠ Y136)
Sites not aligning to the query:
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
28% identity, 65% coverage: 4:162/245 of query aligns to 1:175/314 of 6zljA
- active site: T126 (≠ S111), S127 (≠ A112), S128 (≠ Q113), F149 (≠ Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (≠ R14), I12 (= I15), D32 (= D33), H33 (≠ R34), F34 (vs. gap), I35 (= I35), K43 (vs. gap), D62 (= D50), I63 (≠ L51), L81 (= L70), A82 (≠ S71), A83 (≠ G72), I124 (≠ A109), T126 (≠ S111), K153 (= K140)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (= P74), R88 (≠ S77), T126 (≠ S111), S127 (≠ A112), S128 (≠ Q113), F149 (≠ Y136)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 176, 178, 179, 185, 188
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: 177, 178, 185, 188, 189, 192, 204, 206, 211, 213, 250, 276
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
30% identity, 59% coverage: 3:146/245 of query aligns to 1:157/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (≠ R14), I13 (= I15), D32 (= D33), N33 (≠ R34), S35 (≠ A36), G37 (≠ D38), D57 (= D50), L58 (= L51), F79 (≠ L70), A80 (≠ S71), I83 (≠ P74), N98 (= N86), Y147 (= Y136), K151 (= K140)
Sites not aligning to the query:
Query Sequence
>GFF4297 FitnessBrowser__WCS417:GFF4297
MKGLNILLTGACGRIGKTFFQASQDRYRFTLTDRIAPDFDLGGHRFVHADLSDKSSLATL
LEGIDVIVHLSGIPHASASFEELLPNNILATTYLFEAAVAAGVKRLVFASSAQTIEGYPV
DRQITPGMPVMPANLYGVSKCYGEALCGYYAAKTPLSTIALRIGAFEFPETHDLNNARDL
SAWLSPRDAVQLLQRAVETEGVKHLIAHGISNNRFKRLDLSETTRVLGYQPVDDAFATFE
IPISY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory