Comparing GFF43 FitnessBrowser__Phaeo:GFF43 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
5ti1H Crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
53% identity, 99% coverage: 2:413/418 of query aligns to 11:430/430 of 5ti1H
P35505 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Mus musculus (Mouse) (see 3 papers)
48% identity, 94% coverage: 18:412/418 of query aligns to 12:416/419 of P35505
1hyoB Crystal structure of fumarylacetoacetate hydrolase complexed with 4- (hydroxymethylphosphinoyl)-3-oxo-butanoic acid (see paper)
48% identity, 95% coverage: 18:413/418 of query aligns to 14:419/419 of 1hyoB
2hzyA Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate (see paper)
48% identity, 94% coverage: 18:412/418 of query aligns to 12:416/416 of 2hzyA
1qcoA Crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate (see paper)
48% identity, 94% coverage: 18:412/418 of query aligns to 12:416/416 of 1qcoA
P16930 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Homo sapiens (Human) (see 14 papers)
48% identity, 94% coverage: 18:412/418 of query aligns to 12:416/419 of P16930
Sites not aligning to the query:
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
24% identity, 76% coverage: 37:352/418 of query aligns to 14:272/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
24% identity, 76% coverage: 37:352/418 of query aligns to 15:273/303 of 8sutA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
34% identity, 22% coverage: 179:268/418 of query aligns to 103:191/277 of 6iymA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
24% identity, 49% coverage: 179:382/418 of query aligns to 105:280/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
24% identity, 49% coverage: 179:382/418 of query aligns to 105:280/290 of 8gsrA
>GFF43 FitnessBrowser__Phaeo:GFF43
MPLMKSWVSSANSTAHPFPLNNLPYGVFSVDSDDPRCGVAIGDMILDMQAAEETGLIQLG
DVPLFDVPYWNDLMEEGPAVWAALRDRLTALLSEGAAEQEKVEPLLVAASAAELHMPFAV
SEYTDFYAGKNHAFNVGTMFRGPENALPPNWLHIPIGYNGRASSVVASGTDVRRPWGQLK
GPNDDKPRWAPCARFDIELEMGAIVGTPSEGPITVQEADDHIFGYVLLNDWSARDIQAWE
YQPLGPFQAKATANTISPWIVTKAALEPFRCDTPEREVELLDHLKDCGPMLYDIDLEVTM
APEGKEATTIARTNYKEMYYSAAQQLAHHATSGCPMNAGDLLGSGTISGSTKDSRGSLLE
LSWGGKEPLTLDTGEERSFIADGDTLTLKGAAKGDGYTIGFGDCTGTVLAALEDPYAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory