Comparing GFF4515 FitnessBrowser__WCS417:GFF4515 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WQB3 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
51% identity, 97% coverage: 7:550/559 of query aligns to 42:642/644 of P9WQB3
Sites not aligning to the query:
3hpzB Crystal structure of mycobacterium tuberculosis leua complexed with bromopyruvate
53% identity, 97% coverage: 7:550/559 of query aligns to 25:575/576 of 3hpzB
3figB Crystal structure of leucine-bound leua from mycobacterium tuberculosis (see paper)
53% identity, 97% coverage: 7:550/559 of query aligns to 25:575/577 of 3figB
3hq1A Crystal structure of mycobacterium tuberculosis leua complexed with citrate and mn2+
53% identity, 97% coverage: 7:550/559 of query aligns to 25:572/573 of 3hq1A
1sr9A Crystal structure of leua from mycobacterium tuberculosis (see paper)
53% identity, 97% coverage: 7:550/559 of query aligns to 25:572/573 of 1sr9A
3hpsA Crystal structure of mycobacterium tuberculosis leua complexed with ketoisocaproate (kic)
53% identity, 97% coverage: 7:550/559 of query aligns to 25:574/575 of 3hpsA
4ov9A Structure of isopropylmalate synthase binding with alpha- isopropylmalate (see paper)
28% identity, 64% coverage: 40:394/559 of query aligns to 11:342/380 of 4ov9A
4ov4A Isopropylmalate synthase binding with ketoisovalerate (see paper)
28% identity, 64% coverage: 40:394/559 of query aligns to 11:340/379 of 4ov4A
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
27% identity, 93% coverage: 28:549/559 of query aligns to 2:501/517 of Q9JZG1
Sites not aligning to the query:
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 65% coverage: 38:399/559 of query aligns to 90:444/503 of Q9FN52
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
27% identity, 65% coverage: 38:399/559 of query aligns to 23:377/409 of 6e1jA
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
30% identity, 52% coverage: 38:329/559 of query aligns to 9:288/308 of 3rmjB
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 60% coverage: 38:370/559 of query aligns to 90:412/506 of Q9FG67
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
24% identity, 63% coverage: 36:388/559 of query aligns to 25:346/399 of 6ktqA
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
23% identity, 55% coverage: 38:344/559 of query aligns to 35:320/400 of 3ivtB
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
23% identity, 55% coverage: 38:344/559 of query aligns to 40:325/418 of Q9Y823
Sites not aligning to the query:
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
23% identity, 55% coverage: 38:344/559 of query aligns to 17:291/370 of 3mi3A
Q53WI0 4-hydroxy-2-oxovalerate aldolase; HOA; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxohexanoate aldolase; 4-hydroxy-2-oxopentanoate aldolase; EC 4.1.3.39; EC 4.1.3.43 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
34% identity, 14% coverage: 243:323/559 of query aligns to 198:279/347 of Q53WI0
Sites not aligning to the query:
3ivsA Homocitrate synthase lys4 (see paper)
29% identity, 23% coverage: 215:344/559 of query aligns to 161:289/364 of 3ivsA
Sites not aligning to the query:
2ztjA Crystal structure of homocitrate synthase from thermus thermophilus complexed with alpha-ketoglutarate (see paper)
26% identity, 47% coverage: 38:300/559 of query aligns to 9:239/312 of 2ztjA
>GFF4515 FitnessBrowser__WCS417:GFF4515
MSMLKDPSSKYRAFPTIDIPDRTWPSKTITEAPIWCSSDLRDGNQSLIEPMDAVKKLRFW
KTLVAVGVKEIEASFPAASQTDFDFVRTLIEDNHIPEDTTIQVLTQGREDLIARTFESLR
GAKKAIVHLYNATSPSFRRIVFNQDKEGIKAIAVNAAKLFVKYAAQQPETQWTFEYSPET
FSATELEFAKEVCDAVIEVWNPTPEHKMILNLPATVECATPNIYADQIEWFGRHINRRDS
VIISLHTHNDRGTGVAATELGLMAGADRVEGCLFGNGERTGNVDLVTVALNMYTQGLDPQ
LDFSDIDGVRKVVEECNQIQVHPRHPYVGDLVHTAFSGSHQDAIRKGFSQQKDDALWEVP
YLPIDPADIGRSYEAVIRVNSQSGKGGIAYLLEQEYDISLPRRMQIEFSQVVQAETDRVG
LEMTAPQIYALLQREYLQANTPYALVSHRLQEENGNSFVEVEVSGKGQGETNLHWKGKGN
GALEALVAGLPIGVEIMDYNEHAIGAGTNAKAAAYIELRVNGERPVHGVGIDENITTASF
KALFSALNRSLSQQEAKAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory