SitesBLAST
Comparing GFF453 FitnessBrowser__WCS417:GFF453 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
67% identity, 99% coverage: 2:305/308 of query aligns to 1:304/308 of 6wj9B
- active site: A119 (≠ S120), A120 (= A121), A121 (= A122), F144 (≠ Y145), K148 (= K149)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), F12 (= F13), I13 (= I14), D32 (= D33), D33 (≠ N34), S35 (= S36), T36 (= T37), G37 (= G38), D55 (= D56), A56 (≠ V57), L75 (= L76), A76 (= A77), A77 (= A78), S94 (= S95), A117 (= A118), A119 (≠ S120), F144 (≠ Y145), K148 (= K149), F171 (= F172), F172 (= F173), I174 (= I175)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V82), N173 (= N174), G187 (= G188), V188 (= V189), F192 (= F193), T203 (≠ A204), L204 (≠ V205), F205 (= F206), R212 (= R213), L248 (= L249), R271 (= R272), D274 (= D275)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
68% identity, 98% coverage: 3:305/308 of query aligns to 1:303/307 of 6wjaA
- active site: A118 (≠ S120), A119 (= A121), A120 (= A122), F143 (≠ Y145), K147 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (= D33), D32 (≠ N34), S34 (= S36), T35 (= T37), G36 (= G38), A55 (≠ V57), L74 (= L76), A75 (= A77), A76 (= A78), S93 (= S95), F143 (≠ Y145), K147 (= K149), F170 (= F172), F171 (= F173), I173 (= I175)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V82), A120 (= A122), N172 (= N174), G186 (= G188), V187 (= V189), F191 (= F193), T202 (≠ A204), F204 (= F206), R211 (= R213), L247 (= L249), R270 (= R272), D273 (= D275)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
38% identity, 98% coverage: 5:307/308 of query aligns to 3:302/309 of 4zrnA
- active site: T117 (≠ S120), G119 (≠ A121), A120 (= A122), Y143 (= Y145), K147 (= K149), Y181 (≠ S183), G185 (= G188)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (= D33), N32 (= N34), S34 (= S36), S35 (≠ T37), G36 (= G38), S51 (≠ D56), I52 (≠ V57), L73 (= L76), A74 (= A77), A75 (= A78), T92 (≠ S95), S115 (≠ A118), S116 (= S119), Y143 (= Y145), K147 (= K149), Y170 (≠ F172), V173 (≠ I175)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S120), G119 (≠ A121), A120 (= A122), Y143 (= Y145), N172 (= N174), G185 (= G188), V186 (= V189), H201 (≠ A204), F203 (= F206), Y208 (≠ Q211), R210 (= R213), V244 (≠ L249), R267 (= R272), D270 (= D275)
2p5uA Crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with NAD
42% identity, 97% coverage: 4:303/308 of query aligns to 2:297/311 of 2p5uA
- active site: T117 (≠ S120), G119 (≠ A121), A120 (= A122), Y143 (= Y145), K147 (= K149), H181 (≠ S183), G185 (= G188)
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), F11 (= F13), I12 (= I14), D31 (= D33), N32 (= N34), L33 (= L35), A34 (≠ S36), T35 (= T37), G36 (= G38), D51 (= D56), L52 (≠ V57), Q73 (≠ L76), A74 (= A77), A75 (= A78), A77 (= A80), S116 (= S119), Y143 (= Y145), K147 (= K149), V173 (≠ I175)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
38% identity, 92% coverage: 3:286/308 of query aligns to 4:283/310 of 6dntA
- active site: S120 (= S120), S121 (≠ A121), A122 (= A122), Y144 (= Y145), K148 (= K149), A187 (≠ G188)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (= A80), S120 (= S120), S121 (≠ A121), Y144 (= Y145), F172 (= F173), N173 (= N174), A187 (≠ G188), V188 (= V189), K191 (≠ I192), V203 (≠ A204), I204 (≠ V205), Y205 (≠ F206), Q210 (= Q211), R212 (= R213), I246 (≠ L249), R269 (= R272), D272 (= D275)
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), G13 (= G12), F14 (= F13), I15 (= I14), D33 (= D33), N34 (= N34), L35 (= L35), S36 (= S36), S37 (≠ T37), G38 (= G38), D57 (= D56), L58 (≠ V57), L76 (= L76), A77 (= A77), A78 (= A78), A80 (= A80), S118 (≠ A118), S119 (= S119), Y144 (= Y145), K148 (= K149), Y171 (≠ F172), V174 (≠ I175)
- binding zinc ion: E209 (= E210), H275 (= H278)
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
35% identity, 91% coverage: 3:282/308 of query aligns to 17:304/336 of 3ruhA
- active site: S142 (= S120), S143 (≠ A121), S144 (≠ A122), Y166 (= Y145), K170 (= K149), N204 (≠ S183)
- binding nicotinamide-adenine-dinucleotide: G23 (= G9), G26 (= G12), F27 (= F13), I28 (= I14), D47 (= D33), N48 (= N34), S50 (= S36), T51 (= T37), G52 (= G38), D78 (= D56), I79 (≠ V57), Q98 (≠ L76), A99 (= A77), A100 (= A78), T117 (≠ S95), A140 (= A118), A141 (≠ S119), S142 (= S120), Y166 (= Y145), K170 (= K149), Y193 (≠ F172), V196 (≠ I175)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (≠ A80), S103 (= S81), S142 (= S120), S143 (≠ A121), S144 (≠ A122), Y166 (= Y145), Y193 (≠ F172), N195 (= N174), A209 (≠ G188), V210 (= V189), K213 (≠ I192), W214 (≠ F193), Y225 (≠ A204), I226 (≠ V205), N227 (≠ F206), R234 (= R213), L271 (= L249), R294 (= R272), D297 (= D275), V298 (≠ I276), S301 (= S279)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
35% identity, 91% coverage: 3:282/308 of query aligns to 17:304/336 of 3rufA
- active site: S142 (= S120), S143 (≠ A121), S144 (≠ A122), Y166 (= Y145), K170 (= K149), N204 (≠ S183)
- binding nicotinamide-adenine-dinucleotide: G23 (= G9), G26 (= G12), F27 (= F13), I28 (= I14), D47 (= D33), N48 (= N34), S50 (= S36), T51 (= T37), G52 (= G38), D78 (= D56), I79 (≠ V57), Q98 (≠ L76), A99 (= A77), A100 (= A78), T117 (≠ S95), A140 (= A118), Y166 (= Y145), K170 (= K149), Y193 (≠ F172), V196 (≠ I175)
- binding uridine-5'-diphosphate: N195 (= N174), A209 (≠ G188), V210 (= V189), K213 (≠ I192), W214 (≠ F193), Y225 (≠ A204), I226 (≠ V205), N227 (≠ F206), R234 (= R213), L271 (= L249), R294 (= R272), D297 (= D275)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
35% identity, 91% coverage: 3:282/308 of query aligns to 17:304/336 of 3lu1A
- active site: S142 (= S120), S143 (≠ A121), S144 (≠ A122), Y166 (= Y145), K170 (= K149), N204 (≠ S183)
- binding glycine: Q135 (≠ K113), K187 (≠ E166)
- binding nicotinamide-adenine-dinucleotide: G23 (= G9), G26 (= G12), F27 (= F13), I28 (= I14), D47 (= D33), N48 (= N34), S50 (= S36), T51 (= T37), G52 (= G38), D78 (= D56), I79 (≠ V57), Q98 (≠ L76), A99 (= A77), A100 (= A78), A140 (= A118), A141 (≠ S119), S142 (= S120), Y166 (= Y145), K170 (= K149), Y193 (≠ F172), N195 (= N174)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S81), S142 (= S120), S143 (≠ A121), S144 (≠ A122), Y166 (= Y145), N195 (= N174), V210 (= V189), W214 (≠ F193), Y225 (≠ A204), I226 (≠ V205), N227 (≠ F206), R234 (= R213), L271 (= L249), R294 (= R272), D297 (= D275)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
36% identity, 91% coverage: 3:282/308 of query aligns to 17:309/341 of 1sb8A
- active site: S142 (= S120), S143 (≠ A121), S144 (≠ A122), Y166 (= Y145), K170 (= K149), N204 (≠ S183)
- binding nicotinamide-adenine-dinucleotide: G23 (= G9), G26 (= G12), F27 (= F13), I28 (= I14), D47 (= D33), N48 (= N34), F49 (≠ L35), T51 (= T37), G52 (= G38), D78 (= D56), I79 (≠ V57), Q98 (≠ L76), A100 (= A78), T117 (≠ S95), A140 (= A118), A141 (≠ S119), Y166 (= Y145), K170 (= K149), Y193 (≠ F172), N195 (= N174), V196 (≠ I175)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S81), S142 (= S120), S143 (≠ A121), S144 (≠ A122), Y166 (= Y145), N195 (= N174), A209 (≠ G188), V210 (= V189), W214 (≠ F193), Y225 (≠ A204), I226 (≠ V205), N227 (≠ F206), R234 (= R213), L271 (= L249), R299 (= R272), D302 (= D275), S306 (= S279)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
36% identity, 91% coverage: 3:282/308 of query aligns to 16:308/340 of 1sb9A
- active site: S141 (= S120), S142 (≠ A121), S143 (≠ A122), Y165 (= Y145), K169 (= K149), N203 (≠ S183)
- binding nicotinamide-adenine-dinucleotide: G22 (= G9), G25 (= G12), F26 (= F13), I27 (= I14), D46 (= D33), N47 (= N34), F48 (≠ L35), T50 (= T37), G51 (= G38), D77 (= D56), I78 (≠ V57), Q97 (≠ L76), A99 (= A78), T116 (≠ S95), A139 (= A118), A140 (≠ S119), Y165 (= Y145), K169 (= K149), Y192 (≠ F172), N194 (= N174), V195 (≠ I175)
- binding uridine-5'-diphosphate-glucose: S141 (= S120), Y165 (= Y145), N194 (= N174), A208 (≠ G188), V209 (= V189), W213 (≠ F193), Y224 (≠ A204), I225 (≠ V205), N226 (≠ F206), L270 (= L249), R298 (= R272), D301 (= D275)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
36% identity, 91% coverage: 3:282/308 of query aligns to 20:312/345 of Q7BJX9
- GVAGFI 26:31 (≠ GGAGFI 9:14) binding
- DNFSTG 50:55 (≠ DNLSTG 33:38) binding
- DI 81:82 (≠ DV 56:57) binding
- QAA 101:103 (≠ LAA 76:78) binding
- T120 (≠ S95) binding
- SS 145:146 (≠ SA 120:121) binding
- S147 (≠ A122) mutation to T: No effect on epimerase activity.
- Y169 (= Y145) binding
- K173 (= K149) binding
- YFN 196:198 (≠ FFN 172:174) binding
- V199 (≠ I175) binding
- VIPK 213:216 (≠ VISI 189:192) binding
- YIN 228:230 (≠ AVF 204:206) binding
- S236 (≠ T212) mutation to G: No effect on epimerase activity.
- R237 (= R213) binding
- R271 (≠ T246) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (= RSGD 272:275) binding
- R307 (= R277) mutation to A: No effect on epimerase activity.
- H308 (= H278) mutation to A: No effect on epimerase activity.
- S309 (= S279) mutation to Y: Abolishes epimerase activity.
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
36% identity, 89% coverage: 3:276/308 of query aligns to 8:278/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G9), G17 (= G12), F18 (= F13), I19 (= I14), D37 (= D33), N38 (= N34), E40 (≠ S36), R41 (≠ T37), N61 (≠ D56), V62 (= V57), A81 (≠ L76), A82 (= A77), A83 (= A78), F124 (≠ A118), K154 (= K149), P177 (≠ F172), N179 (= N174)
- binding uridine-5'-diphosphate: R147 (≠ P141), G189 (= G188), A190 (≠ V189), M194 (≠ F193), Y205 (≠ A204), I206 (≠ V205), F207 (= F206), R214 (= R213), I251 (≠ L249)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
30% identity, 97% coverage: 4:303/308 of query aligns to 2:304/314 of 6zldA
- active site: T126 (≠ S120), S127 (≠ A121), S128 (≠ A122), Y149 (= Y145), K153 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D32 (= D33), H33 (≠ N34), F34 (vs. gap), I35 (vs. gap), K43 (≠ S36), D62 (= D56), I63 (≠ V57), L81 (= L76), A82 (= A77), A83 (= A78), I124 (≠ A118), T126 (≠ S120), K153 (= K149), Y176 (≠ F172), T178 (≠ N174), R185 (≠ D181), M188 (≠ S184)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ A80), R88 (≠ Q83), T126 (≠ S120), S127 (≠ A121), S128 (≠ A122), Y149 (= Y145), F177 (= F173), T178 (≠ N174), R185 (≠ D181), M188 (≠ S184), A189 (≠ P185), R192 (≠ G188), T204 (≠ A204), F206 (= F206), Q211 (= Q211), R213 (= R213), I250 (≠ L249), E276 (≠ D275)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
30% identity, 97% coverage: 4:303/308 of query aligns to 2:304/314 of 6zl6A
- active site: T126 (≠ S120), S127 (≠ A121), S128 (≠ A122), Y149 (= Y145), K153 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D32 (= D33), H33 (≠ N34), F34 (vs. gap), I35 (vs. gap), K43 (≠ S36), D62 (= D56), I63 (≠ V57), L81 (= L76), A82 (= A77), A83 (= A78), I124 (≠ A118), T126 (≠ S120), K153 (= K149), Y176 (≠ F172), T178 (≠ N174), V179 (≠ I175), R185 (≠ D181), M188 (≠ S184)
- binding uridine-5'-diphosphate: T178 (≠ N174), A189 (≠ P185), R192 (≠ G188), T204 (≠ A204), F206 (= F206), Q211 (= Q211), R213 (= R213), I250 (≠ L249), E276 (≠ D275)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
30% identity, 97% coverage: 4:303/308 of query aligns to 2:304/321 of 6zllA
- active site: T126 (≠ S120), S127 (≠ A121), S128 (≠ A122), Y149 (= Y145), K153 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D32 (= D33), H33 (≠ N34), F34 (vs. gap), I35 (vs. gap), K43 (≠ S36), D62 (= D56), I63 (≠ V57), L81 (= L76), A82 (= A77), A83 (= A78), I124 (≠ A118), T126 (≠ S120), Y149 (= Y145), K153 (= K149), Y176 (≠ F172), V179 (≠ I175), R185 (≠ D181), M188 (≠ S184)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ A80), V87 (= V82), R88 (≠ Q83), T126 (≠ S120), S127 (≠ A121), Y149 (= Y145), T178 (≠ N174), R185 (≠ D181), A189 (≠ P185), R192 (≠ G188), T204 (≠ A204), F206 (= F206), Q211 (= Q211), R213 (= R213), I250 (≠ L249), E276 (≠ D275)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
39% identity, 90% coverage: 4:279/308 of query aligns to 2:278/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ A80), R84 (≠ Q83), S121 (= S120), G123 (≠ A121), Y146 (= Y145), A174 (≠ F173), N175 (= N174), A187 (≠ S187), G188 (= G188), V189 (= V189), F193 (= F193), R204 (≠ A204), F206 (= F206), N211 (≠ Q211), R213 (= R213), D248 (≠ L249), R271 (= R272)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (= D33), N32 (= N34), A34 (≠ S36), T35 (= T37), G36 (= G38), D56 (= D56), I57 (≠ V57), L77 (= L76), A78 (= A77), A79 (= A78), I81 (≠ A80), T119 (≠ A118), Y146 (= Y145), K150 (= K149), P173 (≠ F172), A174 (≠ F173), V176 (≠ I175)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A80), R84 (≠ Q83), S121 (= S120), G123 (≠ A121), Y146 (= Y145), A174 (≠ F173), N175 (= N174), A187 (≠ S187), G188 (= G188), V189 (= V189), F193 (= F193), R204 (≠ A204), F206 (= F206), N211 (≠ Q211), R213 (= R213), D248 (≠ L249), R271 (= R272)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
39% identity, 90% coverage: 4:279/308 of query aligns to 2:278/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (= D33), N32 (= N34), T35 (= T37), G36 (= G38), D56 (= D56), I57 (≠ V57), L77 (= L76), A78 (= A77), A79 (= A78), I81 (≠ A80), V96 (≠ S95), T119 (≠ A118), Y146 (= Y145), K150 (= K149), P173 (≠ F172), A174 (≠ F173), N175 (= N174), V176 (≠ I175)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A80), R84 (≠ Q83), S121 (= S120), G123 (≠ A121), Y146 (= Y145), A174 (≠ F173), N175 (= N174), A187 (≠ S187), G188 (= G188), V189 (= V189), F193 (= F193), R204 (≠ A204), V205 (= V205), F206 (= F206), R213 (= R213), D248 (≠ L249), R271 (= R272)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
39% identity, 90% coverage: 4:279/308 of query aligns to 2:278/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (= D33), N32 (= N34), T35 (= T37), G36 (= G38), D56 (= D56), I57 (≠ V57), L77 (= L76), A78 (= A77), A79 (= A78), I81 (≠ A80), T119 (≠ A118), Y146 (= Y145), K150 (= K149), P173 (≠ F172), N175 (= N174), V176 (≠ I175)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ A80), R84 (≠ Q83), S121 (= S120), G123 (≠ A121), S124 (≠ A122), Y146 (= Y145), A174 (≠ F173), N175 (= N174), G188 (= G188), V189 (= V189), F193 (= F193), R204 (≠ A204), V205 (= V205), F206 (= F206), N211 (≠ Q211), R213 (= R213), D248 (≠ L249), R271 (= R272)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
30% identity, 97% coverage: 4:303/308 of query aligns to 2:304/314 of 6zljA
- active site: T126 (≠ S120), S127 (≠ A121), S128 (≠ A122), F149 (≠ Y145), K153 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D32 (= D33), H33 (≠ N34), F34 (vs. gap), I35 (vs. gap), K43 (≠ S36), D62 (= D56), I63 (≠ V57), L81 (= L76), A82 (= A77), A83 (= A78), I124 (≠ A118), T126 (≠ S120), K153 (= K149), Y176 (≠ F172), T178 (≠ N174), V179 (≠ I175), R185 (≠ D181), M188 (≠ S184)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ A80), R88 (≠ Q83), T126 (≠ S120), S127 (≠ A121), S128 (≠ A122), F149 (≠ Y145), F177 (= F173), T178 (≠ N174), R185 (≠ D181), M188 (≠ S184), A189 (≠ P185), R192 (≠ G188), T204 (≠ A204), F206 (= F206), Q211 (= Q211), R213 (= R213), I250 (≠ L249), E276 (≠ D275)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
32% identity, 97% coverage: 4:303/308 of query aligns to 2:299/313 of 6bwlA
- active site: T122 (≠ S120), C123 (≠ A121), M124 (≠ A122), Y147 (= Y145), K151 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (= D33), N32 (= N34), L33 (= L35), N35 (≠ T37), S36 (≠ G38), D57 (= D56), I58 (≠ V57), L79 (= L76), A80 (= A77), A81 (= A78), I83 (≠ A80), M120 (≠ A118), K151 (= K149), N176 (= N174), T177 (≠ I175)
- binding uridine-5'-diphosphate: N176 (= N174), G189 (= G188), V190 (= V189), N205 (≠ A204), I206 (≠ V205), Y207 (≠ F206), Q212 (= Q211), R214 (= R213), I250 (≠ L249), E275 (≠ N282)
Query Sequence
>GFF453 FitnessBrowser__WCS417:GFF453
MSKRVLITGGAGFIGSHLVDALLAKGYGVRVLDNLSTGKRSNLPLDNPRVELLEGDVADA
ELVARAAVDTTAVVHLAAVASVQASVDDPVSTHQSNFVGTLNVCEAMRKAGVKRVVYASS
AAVYGNNGEGASIDEETTKAPLTPYASDKLAGEHYFDFYRRQHGLEPVIFRFFNIFGPRQ
DPSSPYSGVISIFSERAQQGVPIAVFGDGEQTRDFMYVEDLVDVLVQAIEAPSAPLGAIN
VGWNRTTTLKQVLQALEEIVGKLPTVTYGPARSGDIRHSRANNQRLLASFTLPEPTPLKV
GLERLLEG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory