Comparing GFF499 FitnessBrowser__Phaeo:GFF499 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hmcA The crystal structure of dihydrodipicolinate synthase dapa from agrobacterium tumefaciens
75% identity, 97% coverage: 1:310/319 of query aligns to 5:314/314 of 2hmcA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
33% identity, 62% coverage: 5:203/319 of query aligns to 1:203/294 of Q8UGL3
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
30% identity, 67% coverage: 5:217/319 of query aligns to 1:211/292 of Q07607
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
31% identity, 62% coverage: 5:203/319 of query aligns to 1:203/294 of 4i7wA
Sites not aligning to the query:
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
27% identity, 73% coverage: 9:240/319 of query aligns to 10:240/307 of 4fhaA
5c55A Crystal structure of the y138f mutant of c.Glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
29% identity, 70% coverage: 6:227/319 of query aligns to 2:227/307 of 5c55A
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
29% identity, 69% coverage: 5:224/319 of query aligns to 2:223/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
29% identity, 69% coverage: 5:224/319 of query aligns to 2:223/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 69% coverage: 5:224/319 of query aligns to 2:223/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 69% coverage: 5:224/319 of query aligns to 2:223/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 69% coverage: 5:224/319 of query aligns to 2:223/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
29% identity, 69% coverage: 5:224/319 of query aligns to 2:223/298 of 3nevA
Q86XE5 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; Dihydrodipicolinate synthase-like; DHDPS-like protein; Probable 2-keto-4-hydroxyglutarate aldolase; Probable KHG-aldolase; Protein 569272; EC 4.1.3.16 from Homo sapiens (Human) (see paper)
29% identity, 70% coverage: 6:227/319 of query aligns to 35:257/327 of Q86XE5
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
27% identity, 67% coverage: 5:219/319 of query aligns to 4:216/295 of Q5HG25
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
27% identity, 67% coverage: 5:219/319 of query aligns to 4:216/291 of 3di1B
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
29% identity, 53% coverage: 5:172/319 of query aligns to 1:170/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
29% identity, 53% coverage: 5:172/319 of query aligns to 1:170/296 of 7lvlA
Sites not aligning to the query:
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
25% identity, 74% coverage: 5:241/319 of query aligns to 2:236/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
25% identity, 74% coverage: 5:241/319 of query aligns to 1:235/294 of Q9X1K9
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
29% identity, 57% coverage: 6:188/319 of query aligns to 5:196/295 of 5ktlA
Sites not aligning to the query:
>GFF499 FitnessBrowser__Phaeo:GFF499
MTNPVFSGCIPALMTPCTADRRPDFDGLVKKGQELIAKGMSAVVYCGSMGDWPLISDAER
MEGVARLVAAGVPTIVGTGAVNTTQAAAHAAHAAEVGAAGLMVIPRVLSRGSSVAAQRDH
FAAVLSAAPTLPAVIYNSPYYGFATRADLFFDLRQDHPNLIGFKEFGGADDLRYAAENIT
SQDSSVTLMIGVDTTVFHGYVNCGAGGAITGIGNALPDEVLHLVALCQLAAKGNATARRQ
ALELEAALAVLSSFDEGADLVLYYKHLMVLNGDGEYRLHFNESDRLSASQQAYVEAQYAL
FRSWYADWSQQPDIAALCA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory