Comparing GFF503 FitnessBrowser__psRCH2:GFF503 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
39% identity, 97% coverage: 12:418/421 of query aligns to 5:409/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
39% identity, 97% coverage: 12:418/421 of query aligns to 5:409/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
31% identity, 98% coverage: 2:414/421 of query aligns to 1:408/412 of 4jbeB
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
24% identity, 78% coverage: 87:413/421 of query aligns to 73:436/456 of 5j7iB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
24% identity, 78% coverage: 87:413/421 of query aligns to 72:435/455 of 5j7iC
>GFF503 FitnessBrowser__psRCH2:GFF503
MTESVLDYMTRLGRAAREASRVLARASTAQKNRALQAAAAALDAARDELVRANELDLAGG
RANGLDAAMLDRLALTPKVIDGMIEGLRQVATLPDPIGAIRDMRYMPSGIQVGKMRVPLG
VVGIIYESRPNVTIDAASLCLKSGNATILRGGSEAIHSNQAIARCIQLGLAEAGLPAAAV
QVVETTDRAAVGALISMPEFVDVIVPRGGKGLIERISRDARVPVIKHLDGICHVYIDVAA
DVDKAIRIADNAKTQRFAPCNTMETLLVHPGIAEQVLPPLAAIYREKSVELRGCPRTRAL
LGSDVLEASEEDWSTEYNAPILSIRLVDSLDAAIEHINRYGSQHTDAIVTENFTDARRFL
TEVDSASVMINASTRFADGFEYGLGAEIGISTDKLHARGPVGLEGLTSEKYVVFGDGHVR
T
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory