SitesBLAST
Comparing GFF624 FitnessBrowser__Phaeo:GFF624 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4gljA Crystal structure of methylthioadenosine phosphorylase in complex with rhodamine b (see paper)
49% identity, 83% coverage: 53:331/337 of query aligns to 6:285/287 of 4gljA
- active site: D212 (= D256), D214 (= D258)
- binding N-[9-(2-carboxyphenyl)-6-(diethylamino)-3H-xanthen-3-ylidene]-N-ethylethanaminium: S12 (= S59), Y15 (= Y62), H55 (= H102), A88 (= A135), G90 (= G137), F169 (= F213), F169 (= F213), I186 (= I230), G187 (= G231), M188 (= M232), D212 (= D256), F213 (= F257), D214 (= D258), N219 (≠ D263), A228 (≠ I272), I229 (= I273), L232 (= L276)
3t94A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase (mtap) ii complexed with 5'-deoxy-5'-methylthioadenosine and sulfate (see paper)
47% identity, 78% coverage: 48:309/337 of query aligns to 5:269/270 of 3t94A
- active site: S16 (= S59), P39 (= P82), H63 (= H106), I65 (≠ H108), P66 (≠ S109), A92 (= A135), M190 (= M232), T191 (= T233), D214 (= D256), D216 (= D258), A225 (= A266)
- binding 5'-deoxy-5'-methylthioadenosine: G94 (= G137), F170 (= F213), I188 (= I230), M190 (= M232), D214 (= D256), A225 (= A266), V228 (≠ I269)
Q97W94 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; MTAPII; EC 2.4.2.28 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
47% identity, 78% coverage: 48:309/337 of query aligns to 5:269/270 of Q97W94
- C138 (= C181) modified: Disulfide link with 205
- C200 (≠ R242) modified: Disulfide link with 262
- C205 (= C247) modified: Disulfide link with 138
- C259 (≠ A299) modified: Disulfide link with 261; mutation to S: Reduces thermostability of the enzyme; when associated with S-261.
- C261 (= C301) modified: Disulfide link with 259; mutation to S: Reduces thermostability of the enzyme; when associated with S-259.
- C262 (≠ P302) modified: Disulfide link with 200; mutation to S: Reduces thermostability of the enzyme.
Q8U4Q8 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; PfMTAP; EC 2.4.2.28 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
45% identity, 74% coverage: 53:301/337 of query aligns to 4:248/257 of Q8U4Q8
- C130 (= C181) modified: Disulfide link with 195
- C195 (= C247) modified: Disulfide link with 130
- C246 (≠ A299) modified: Disulfide link with 248
- C248 (= C301) modified: Disulfide link with 246
6dz0A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((pent-4-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
44% identity, 74% coverage: 48:297/337 of query aligns to 1:255/274 of 6dz0A
- active site: T12 (≠ S59), P35 (= P82), H59 (= H106), I61 (≠ H108), M62 (≠ S109), A88 (= A135), M190 (= M232), T191 (= T233), D214 (= D256), D216 (= D258), V227 (≠ I269)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(pent-4-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T12 (≠ S59), H59 (= H106), A88 (= A135), C89 (= C136), G90 (= G137), F171 (= F213), I188 (= I230), N189 (≠ G231), M190 (= M232), T213 (= T255), D214 (= D256), D216 (= D258), V227 (≠ I269), V230 (≠ I272)
- binding phosphate ion: G11 (= G58), T12 (≠ S59), R54 (= R101), H55 (= H102), T87 (≠ S134), T191 (= T233)
6dz3A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-(((3-(1-butyl-1h-1,2,3-triazol-4-yl) propyl)thio)methyl)pyrrolidin-3-ol (see paper)
45% identity, 73% coverage: 53:297/337 of query aligns to 4:253/273 of 6dz3A
- active site: T10 (≠ S59), P33 (= P82), H57 (= H106), I59 (≠ H108), M60 (≠ S109), A86 (= A135), M188 (= M232), T189 (= T233), D212 (= D256), D214 (= D258), V225 (≠ I269)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-({[3-(1-butyl-1H-1,2,3-triazol-4-yl)propyl]sulfanyl}methyl)pyrrolidin-3-ol: T84 (≠ I133), A86 (= A135), C87 (= C136), G88 (= G137), F169 (= F213), I186 (= I230), N187 (≠ G231), M188 (= M232), D212 (= D256), D214 (= D258), V228 (≠ I272), L232 (= L276)
6dyzA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((prop-2-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
45% identity, 73% coverage: 53:297/337 of query aligns to 4:253/273 of 6dyzA
- active site: T10 (≠ S59), P33 (= P82), H57 (= H106), I59 (≠ H108), M60 (≠ S109), A86 (= A135), M188 (= M232), T189 (= T233), D212 (= D256), D214 (= D258), V225 (≠ I269)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(prop-2-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (≠ S59), H57 (= H106), A86 (= A135), C87 (= C136), G88 (= G137), F169 (= F213), I186 (= I230), N187 (≠ G231), M188 (= M232), D212 (= D256), D214 (= D258), V228 (≠ I272)
- binding phosphate ion: G9 (= G58), T10 (≠ S59), R52 (= R101), H53 (= H102), T85 (≠ S134), A86 (= A135), T189 (= T233)
5tc8A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with methylthio-dadme-immucillin-a
45% identity, 73% coverage: 53:297/337 of query aligns to 4:253/273 of 5tc8A
- active site: T10 (≠ S59), P33 (= P82), H57 (= H106), I59 (≠ H108), M60 (≠ S109), A86 (= A135), M188 (= M232), T189 (= T233), D212 (= D256), D214 (= D258), V225 (≠ I269)
- binding (3r,4s)-1-[(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol: T10 (≠ S59), A86 (= A135), C87 (= C136), G88 (= G137), F169 (= F213), I186 (= I230), N187 (≠ G231), M188 (= M232), T211 (= T255), D212 (= D256), D214 (= D258), V228 (≠ I272)
5tc6A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with propylthio-immucillin-a
45% identity, 73% coverage: 53:297/337 of query aligns to 4:253/273 of 5tc6A
- active site: T10 (≠ S59), P33 (= P82), H57 (= H106), I59 (≠ H108), M60 (≠ S109), A86 (= A135), M188 (= M232), T189 (= T233), D212 (= D256), D214 (= D258), V225 (≠ I269)
- binding (2S,3S,4R,5S)-2-(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(propylsulfanyl)methyl]pyrrolidine-3,4-diol: T10 (≠ S59), A86 (= A135), C87 (= C136), G88 (= G137), F169 (= F213), N187 (≠ G231), M188 (= M232), D212 (= D256), V225 (≠ I269), V228 (≠ I272), L229 (≠ I273)
3ozcA Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase in complex with pcl-phenylthiodadmeimma
45% identity, 73% coverage: 53:297/337 of query aligns to 4:253/273 of 3ozcA
- active site: T10 (≠ S59), P33 (= P82), H57 (= H106), I59 (≠ H108), M60 (≠ S109), A86 (= A135), M188 (= M232), T189 (= T233), D212 (= D256), D214 (= D258), V225 (≠ I269)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(4-chlorophenyl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (≠ S59), H57 (= H106), A86 (= A135), C87 (= C136), G88 (= G137), F169 (= F213), I186 (= I230), N187 (≠ G231), M188 (= M232), D212 (= D256), D214 (= D258), V228 (≠ I272), L229 (≠ I273)
5eubA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-mta and sulfate
45% identity, 73% coverage: 53:297/337 of query aligns to 3:252/272 of 5eubA
- active site: T9 (≠ S59), P32 (= P82), H56 (= H106), I58 (≠ H108), M59 (≠ S109), A85 (= A135), M187 (= M232), T188 (= T233), D211 (= D256), D213 (= D258), V224 (≠ I269)
- binding (2~{R},3~{R},4~{S},5~{S})-2-[2,6-bis(azanyl)purin-9-yl]-5-(methylsulfanylmethyl)oxolane-3,4-diol: A85 (= A135), C86 (= C136), G87 (= G137), F168 (= F213), I185 (= I230), N186 (≠ G231), T210 (= T255), D211 (= D256), D213 (= D258), V227 (≠ I272)
5tc5A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with butylthio-dadme-immucillin-a and chloride
45% identity, 73% coverage: 53:297/337 of query aligns to 17:266/286 of 5tc5A
- active site: T23 (≠ S59), P46 (= P82), H70 (= H106), I72 (≠ H108), M73 (≠ S109), A99 (= A135), M201 (= M232), T202 (= T233), D225 (= D256), D227 (= D258), V238 (≠ I269)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(butylsulfanyl)methyl]pyrrolidin-3-ol: A99 (= A135), C100 (= C136), G101 (= G137), F182 (= F213), I199 (= I230), M201 (= M232), D225 (= D256), D227 (= D258), V241 (≠ I272)
1sd2A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-methylthiotubercidin (see paper)
46% identity, 73% coverage: 53:297/337 of query aligns to 4:242/262 of 1sd2A
- active site: T10 (≠ S59), P33 (= P82), H57 (= H106), I59 (≠ H108), M60 (≠ S109), A86 (= A135), M182 (= M232), T183 (= T233), D206 (= D256), D208 (= D258), V214 (≠ I269)
- binding 2-(4-amino-pyrrolo[2,3-d]pyrimidin-7-yl)-5-methylsulfanylmethyl-tetrahydro-furan-3,4-diol: C87 (= C136), G88 (= G137), F163 (= F213), I180 (= I230), N181 (≠ G231), M182 (= M232), D206 (= D256), V217 (≠ I272)
1wtaA Crystal structure of 5'-deoxy-5'-methylthioadenosine from aeropyrum pernix (r32 form)
47% identity, 76% coverage: 53:308/337 of query aligns to 12:271/273 of 1wtaA
1k27A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with a transition state analogue (see paper)
45% identity, 73% coverage: 53:297/337 of query aligns to 4:250/270 of 1k27A
- active site: T10 (≠ S59), P33 (= P82), H57 (= H106), I59 (≠ H108), M60 (≠ S109), A86 (= A135), M188 (= M232), T189 (= T233), D212 (= D256), D214 (= D258), V222 (≠ I269)
- binding (3s,4r)-2-(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(methylsulfanyl)methyl]pyrrolidine-3,4-diol: A86 (= A135), C87 (= C136), G88 (= G137), F169 (= F213), N187 (≠ G231), M188 (= M232), D212 (= D256), V225 (≠ I272)
- binding phosphate ion: G9 (= G58), T10 (≠ S59), R52 (= R101), H53 (= H102), T85 (≠ S134), A86 (= A135), T189 (= T233)
1sd1A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with formycin a (see paper)
45% identity, 73% coverage: 53:297/337 of query aligns to 4:248/268 of 1sd1A
- active site: T10 (≠ S59), P33 (= P82), H57 (= H106), I59 (≠ H108), M60 (≠ S109), A86 (= A135), M188 (= M232), T189 (= T233), D212 (= D256), D214 (= D258), V220 (≠ I269)
- binding (1S)-1-(7-amino-1H-pyrazolo[4,3-d]pyrimidin-3-yl)-1,4-anhydro-D-ribitol: A86 (= A135), C87 (= C136), G88 (= G137), F169 (= F213), I186 (= I230), N187 (≠ G231), M188 (= M232), D212 (= D256), D214 (= D258)
1cg6A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-deoxy-5'-methylthioadenosine and sulfate at 1.7 a resolution (see paper)
45% identity, 73% coverage: 53:297/337 of query aligns to 4:248/268 of 1cg6A
- active site: T10 (≠ S59), P33 (= P82), H57 (= H106), I59 (≠ H108), M60 (≠ S109), A86 (= A135), M188 (= M232), T189 (= T233), D212 (= D256), D214 (= D258), V220 (≠ I269)
- binding 5'-deoxy-5'-methylthioadenosine: A86 (= A135), C87 (= C136), G88 (= G137), F169 (= F213), N187 (≠ G231), M188 (= M232), D212 (= D256), V223 (≠ I272)
- binding sulfate ion: G9 (= G58), T10 (≠ S59), R52 (= R101), H53 (= H102), T85 (≠ S134), T189 (= T233)
1cb0A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase at 1.7 a resolution (see paper)
45% identity, 73% coverage: 53:297/337 of query aligns to 4:248/268 of 1cb0A
- active site: T10 (≠ S59), P33 (= P82), H57 (= H106), I59 (≠ H108), M60 (≠ S109), A86 (= A135), M188 (= M232), T189 (= T233), D212 (= D256), D214 (= D258), V220 (≠ I269)
- binding adenine: C87 (= C136), G88 (= G137), F169 (= F213), D212 (= D256), D214 (= D258)
6dz2A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-(((3-(1-benzyl-1h-1,2,3-triazol-4-yl) propyl)thio)methyl)pyrrolidin-3-ol (see paper)
44% identity, 73% coverage: 53:297/337 of query aligns to 4:250/270 of 6dz2A
- active site: T10 (≠ S59), P33 (= P82), I56 (≠ H108), M57 (≠ S109), A83 (= A135), M185 (= M232), T186 (= T233), D209 (= D256), D211 (= D258), V222 (≠ I269)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-({[3-(1-benzyl-1H-1,2,3-triazol-4-yl)propyl]sulfanyl}methyl)pyrrolidin-3-ol: G8 (= G57), T10 (≠ S59), T81 (≠ I133), T82 (≠ S134), A83 (= A135), C84 (= C136), G85 (= G137), F166 (= F213), I183 (= I230), N184 (≠ G231), M185 (= M232), D209 (= D256), L229 (= L276)
5f7jB Crystal structure of mutant n87t of adenosine/methylthioadenosine phosphorylase from schistosoma mansoni in complex with adenine (see paper)
39% identity, 72% coverage: 53:295/337 of query aligns to 6:269/291 of 5f7jB
- active site: K34 (≠ A81), H59 (= H106), D230 (= D256), D232 (= D258)
- binding adenine: A88 (= A135), C89 (= C136), G90 (= G137), F187 (= F213), V204 (≠ I230), N205 (≠ G231), M206 (= M232), D230 (= D256), D232 (= D258), V246 (≠ I272)
Query Sequence
>GFF624 FitnessBrowser__Phaeo:GFF624
MPPTGRYQSYYPDAADRAVSIKSPLTLVKSGPPKAEPNEQHQGTDHVTQETMIAIIGGSG
LYDIDGLQNAEWVTVETPWGAPSDQILTGTLDGVKMAFLPRHGRGHVHSPTEVPYRANID
ALKRLGVTDVFSISACGSFREEMAPGDFVIVDQFIDRTFAREKSFFGTGCVAHVSVAHPT
CERLSDAAETAARDAGINVHRGGTYLCMEGPQFSSMAESKMYRSWGCDVIGMTNMPEAKL
AREAELCYASIAMVTDFDSWHPDHGAVEITDIIATLTGNSQNGRALVQRLPALLGQTRAA
CPHGCDRALEHAIMTAPEKRSAALLAKLDAVAGRVLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory