Comparing GFF67 FitnessBrowser__Marino:GFF67 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bt9C Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with NADP (see paper)
29% identity, 99% coverage: 2:133/133 of query aligns to 111:242/250 of 5bt9C
Sites not aligning to the query:
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
29% identity, 95% coverage: 4:130/133 of query aligns to 113:244/247 of 4jroC
Sites not aligning to the query:
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
31% identity, 83% coverage: 23:133/133 of query aligns to 122:239/239 of 4nbtA
Sites not aligning to the query:
5iz4A Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
28% identity, 59% coverage: 1:78/133 of query aligns to 114:195/247 of 5iz4A
Sites not aligning to the query:
3gegA Fingerprint and structural analysis of a scor enzyme with its bound cofactor from clostridium thermocellum (see paper)
27% identity, 98% coverage: 1:130/133 of query aligns to 101:223/241 of 3gegA
Sites not aligning to the query:
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
26% identity, 95% coverage: 4:130/133 of query aligns to 114:243/247 of P73574
Sites not aligning to the query:
Q920P0 L-xylulose reductase; XR; Dicarbonyl/L-xylulose reductase; EC 1.1.1.10 from Rattus norvegicus (Rat) (see paper)
29% identity, 80% coverage: 25:130/133 of query aligns to 128:240/244 of Q920P0
5fffA Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and piperonal (see paper)
25% identity, 100% coverage: 1:133/133 of query aligns to 116:255/257 of 5fffA
Sites not aligning to the query:
5ff9B Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and tyramine (see paper)
25% identity, 100% coverage: 1:133/133 of query aligns to 116:255/257 of 5ff9B
Sites not aligning to the query:
A0A1A9TAK5 Noroxomaritidine/norcraugsodine reductase; NorRed; EC 1.1.1.- from Narcissus pseudonarcissus (Daffodil) (see paper)
25% identity, 100% coverage: 1:133/133 of query aligns to 116:255/257 of A0A1A9TAK5
Sites not aligning to the query:
3d3wA Structure of l-xylulose reductase with bound coenzyme, phosphate and hydroxide. (see paper)
28% identity, 80% coverage: 25:130/133 of query aligns to 128:240/244 of 3d3wA
Sites not aligning to the query:
1pr9A Human l-xylulose reductase holoenzyme (see paper)
28% identity, 80% coverage: 25:130/133 of query aligns to 128:240/244 of 1pr9A
Sites not aligning to the query:
Q7Z4W1 L-xylulose reductase; XR; Carbonyl reductase II; Dicarbonyl/L-xylulose reductase; Kidney dicarbonyl reductase; kiDCR; Short chain dehydrogenase/reductase family 20C member 1; Sperm surface protein P34H; EC 1.1.1.10 from Homo sapiens (Human) (see 2 papers)
28% identity, 80% coverage: 25:130/133 of query aligns to 128:240/244 of Q7Z4W1
Sites not aligning to the query:
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
27% identity, 98% coverage: 4:133/133 of query aligns to 112:245/248 of Q9KJF1
Sites not aligning to the query:
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
27% identity, 98% coverage: 4:133/133 of query aligns to 111:244/247 of 7pcsB
Sites not aligning to the query:
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
30% identity, 80% coverage: 28:133/133 of query aligns to 136:246/247 of 3op4A
Sites not aligning to the query:
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
28% identity, 95% coverage: 4:130/133 of query aligns to 106:235/240 of 2d1yA
Sites not aligning to the query:
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
30% identity, 80% coverage: 28:133/133 of query aligns to 136:242/243 of 4i08A
Sites not aligning to the query:
7xqmB Indel-mutant short chain dehydrogenase bound to sah (see paper)
28% identity, 95% coverage: 4:130/133 of query aligns to 104:241/253 of 7xqmB
Sites not aligning to the query:
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
29% identity, 80% coverage: 28:133/133 of query aligns to 136:246/246 of 3osuA
Sites not aligning to the query:
>GFF67 FitnessBrowser__Marino:GFF67
MFMIHMQAPYMINNACDVLFYDNGPADIVHVTDYGAQHGSGKHVAYASTKAGLENMTLSY
AKKLAPRVKVNSIAPFLIMFNKWDSEEYKEKSLNKSVLGIEPGPEVVYQGVRYLMDNIYV
TGECLNLDGGRHL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory