Comparing GFF715 FitnessBrowser__Phaeo:GFF715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
4ru1A Crystal structure of carbohydrate transporter acei_1806 from acidothermus cellulolyticus 11b, target efi-510965, in complex with myo-inositol
32% identity, 88% coverage: 34:312/316 of query aligns to 9:283/288 of 4ru1A
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
26% identity, 84% coverage: 44:308/316 of query aligns to 14:284/305 of 3c6qC
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
27% identity, 84% coverage: 44:308/316 of query aligns to 14:284/313 of 2h3hA
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
23% identity, 80% coverage: 26:279/316 of query aligns to 3:256/283 of 6gt9A
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
23% identity, 78% coverage: 32:279/316 of query aligns to 4:251/278 of 6guqA
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
24% identity, 88% coverage: 30:307/316 of query aligns to 8:284/287 of 7x0hA
5xssA Xylfii molecule (see paper)
22% identity, 79% coverage: 31:279/316 of query aligns to 5:253/274 of 5xssA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
24% identity, 83% coverage: 44:305/316 of query aligns to 19:284/289 of 5hqjA
Sites not aligning to the query:
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
24% identity, 82% coverage: 41:299/316 of query aligns to 17:283/303 of 5dkvA
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
24% identity, 74% coverage: 80:312/316 of query aligns to 53:288/291 of 4rxmA
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
24% identity, 74% coverage: 80:312/316 of query aligns to 51:286/288 of 4rxmB
Sites not aligning to the query:
>GFF715 FitnessBrowser__Phaeo:GFF715
MTSIFKTFMLATTVAAAPMMLATTASAEGEKYILVSHAPDSDSWWNTIKNGIALAGEQMN
VEVEYRNPPTGDLADMARIIEQAAASGPNGIITTLSDYDVLSGPIKAAVDSGVDVIIMNS
GTPDQAREVGALMYVGQPEYDAGHAAGMRAKADGVGSFLCVNHYISSPSSTERCQGFADG
LGVDLGDQMIDSGQDPAEIKNRVLAYLNTNPETDAILTLGPTSADPTLLALDENGMAGDI
YFGTFDLGEEIVKGLKSGVINWGIDQQPFLQAYLPVVVLTNYHRYGVLPGNNINSGPGFV
TKDGLEKVEEFAGEYR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory