Comparing GFF780 FitnessBrowser__Phaeo:GFF780 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
28% identity, 81% coverage: 31:293/325 of query aligns to 3:262/302 of 8hkbA
7ndsA Crystal structure of tphc in a closed conformation (see paper)
27% identity, 66% coverage: 33:246/325 of query aligns to 5:214/294 of 7ndsA
Sites not aligning to the query:
7ndrD Crystal structure of tphc in an open conformation (see paper)
27% identity, 66% coverage: 33:246/325 of query aligns to 5:214/293 of 7ndrD
2f5xB Structure of periplasmic binding protein bugd (see paper)
25% identity, 78% coverage: 33:287/325 of query aligns to 7:258/300 of 2f5xB
6hkeB Matc (rpa3494) from rhodopseudomonas palustris with bound malate (see paper)
24% identity, 77% coverage: 42:291/325 of query aligns to 15:259/296 of 6hkeB
Sites not aligning to the query:
5okuA R. Palustris rpa4515 with adipate (see paper)
26% identity, 77% coverage: 27:277/325 of query aligns to 1:249/299 of 5okuA
5oeiA R. Palustris rpa4515 with oxoadipate (see paper)
26% identity, 77% coverage: 27:277/325 of query aligns to 1:249/299 of 5oeiA
2dvzA Structure of a periplasmic transporter (see paper)
21% identity, 64% coverage: 111:317/325 of query aligns to 90:294/300 of 2dvzA
Sites not aligning to the query:
>GFF780 FitnessBrowser__Phaeo:GFF780
MKMTLTRRALMAVTAATLAFAAPVSADEMVDSIHFLIPGGAGGGWDGTARGTGEALTKAG
LVGNASFENMSGGGGGKAIGYLIENAESNHGTLMVNSTPIVIRSLTGVFPHNFRDLTMVA
GTIGDYAAIVVGKDSPINSMSDLIAAYQADPRKTAIGGGSVPGGMDHLVAAMVMKAAGEE
PTAVKYIPYDAGGVAMAALLSGEIAALSTGFSEAIDLANAGEVKIIGVTAEDRVPAYADA
PTMKEQGIDATFVNWRGFFGAPGLPQEKVDAYRAALAKMYDTPEWEEVRARNGWVNIHNS
GDDFVSFLEGQEEVIKSLMQELGFL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory