Comparing GFF849 FitnessBrowser__psRCH2:GFF849 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1llsA Crystal structure of unliganded maltose binding protein with xenon (see paper)
58% identity, 93% coverage: 27:395/395 of query aligns to 2:370/370 of 1llsA
1ez9B Structure of maltotetraitol bound to open-form maltodextrin binding protein in p1 crystal form (see paper)
58% identity, 93% coverage: 27:395/395 of query aligns to 2:370/370 of 1ez9B
4xajB Crystal structure of human nr2e1/tlx (see paper)
58% identity, 93% coverage: 24:389/395 of query aligns to 1:366/570 of 4xajB
3jyrA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
58% identity, 93% coverage: 27:395/395 of query aligns to 2:370/370 of 3jyrA
6k7fA Crystal structure of mbpholo-tim21 fusion protein with a 17-residue helical linker (see paper)
58% identity, 93% coverage: 27:393/395 of query aligns to 3:369/499 of 6k7fA
5z0rB Structural insight into the zika virus capsid encapsulating the viral genome (see paper)
58% identity, 93% coverage: 27:394/395 of query aligns to 3:370/445 of 5z0rB
6m4wA Crystal structure of mbp fused split fkbp-frb t2098l mutant in complex with rapamycin (see paper)
59% identity, 92% coverage: 27:389/395 of query aligns to 3:365/403 of 6m4wA
7wr3A Crystal structure of mbp-fused ospc3 in complex with calmodulin (see paper)
59% identity, 90% coverage: 27:383/395 of query aligns to 2:358/794 of 7wr3A
Sites not aligning to the query:
5tj2D Gasdermin-b c-terminal domain containing the polymorphism residues gly299:ser306 fused to maltose binding protein
59% identity, 90% coverage: 27:383/395 of query aligns to 2:358/528 of 5tj2D
5tj4E Gasdermin-b c-terminal domain containing the polymorphism residues gly299:pro306 fused to maltose binding protein (see paper)
59% identity, 90% coverage: 27:383/395 of query aligns to 2:358/556 of 5tj4E
6pfoA Crystal structure of n-glycosylated human calcitonin receptor extracellular domain in complex with salmon calcitonin (16-32) (see paper)
58% identity, 93% coverage: 24:389/395 of query aligns to 1:366/474 of 6pfoA
Sites not aligning to the query:
3ob4A Mbp-fusion protein of the major peanut allergen ara h 2 (see paper)
59% identity, 90% coverage: 27:383/395 of query aligns to 2:358/474 of 3ob4A
3vd8A Crystal structure of human aim2 pyd domain with mbp fusion (see paper)
59% identity, 90% coverage: 27:383/395 of query aligns to 2:358/467 of 3vd8A
6sjvA Structure of hpv18 e6 oncoprotein in complex with mutant e6ap lxxll motif
59% identity, 90% coverage: 27:383/395 of query aligns to 2:358/529 of 6sjvA
Sites not aligning to the query:
7cy6A Crystal structure of cmd1 in complex with 5mc-DNA (see paper)
59% identity, 90% coverage: 27:383/395 of query aligns to 1:357/872 of 7cy6A
Sites not aligning to the query:
8c5lB Nr2f6 ligand binding domain in complex with nsd1 peptide
59% identity, 90% coverage: 27:383/395 of query aligns to 3:359/557 of 8c5lB
Sites not aligning to the query:
4ikmA X-ray structure of card8 card domain (see paper)
59% identity, 90% coverage: 27:383/395 of query aligns to 3:359/463 of 4ikmA
5h7qA Crystal structure of human mnda pyd domain with mbp tag (see paper)
59% identity, 90% coverage: 27:383/395 of query aligns to 2:358/469 of 5h7qA
5t05B Crystal structure of heparan sulfate 6-o-sulfotransferase with bound pap and idoa2s containing hexasaccharide substrate (see paper)
59% identity, 90% coverage: 27:383/395 of query aligns to 1:357/677 of 5t05B
Sites not aligning to the query:
4irlB X-ray structure of the card domain of zebrafish gbp-nlrp1 like protein (see paper)
59% identity, 90% coverage: 27:383/395 of query aligns to 3:359/463 of 4irlB
>GFF849 FitnessBrowser__psRCH2:GFF849
MNKKFWCIATVGLAATFSLPLPALAAIEEGKLVVWINGDKGYKGLAEVGKKFTAETGIPV
EVAHPDSATDKFQQAAATGNGPDIFIWAHDRIGEWAKSGLLTPVTPSADTKSGIADFSWQ
AVTYDNKLWGYPISVETIGLIYNKALVDTPPKTFDDVMALNEKLAAQGKRAILWDYNNTY
FTWPLLSAKGGYVFEHADGGYDVKSTGVNNAGAKAGAQVLRDLIDKGVMPKGADYSVAEA
AFNKGDSAMMISGPWAWSNIEKSGIDFGVAPIPAIDGEPGKPFVGVAAALLNAASPNKDL
AVEFLENYLLQVEGLKTVNADVPLGAVANTAYMEELSANPHIKATFENAQMGEPMPNVPE
MGAFWSSMAAALTNITSGRQDVDAALDDAAKRITR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory