Comparing GFF854 FitnessBrowser__WCS417:GFF854 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
25% identity, 94% coverage: 3:147/154 of query aligns to 501:646/650 of O31645
Sites not aligning to the query:
C0H3V2 Mannitol-specific phosphotransferase enzyme IIA component; EIIA; EIII; PTS system mannitol-specific EIIA component from Bacillus subtilis (strain 168) (see paper)
30% identity, 66% coverage: 43:143/154 of query aligns to 37:135/143 of C0H3V2
>GFF854 FitnessBrowser__WCS417:GFF854
MIRLETILTPGRSLVNAPGGSKKKALEQIANLISREVPELEMQDVYEALIAREKLGSTGF
GNGIAIPHCRLKGCETPVSALLHLDAPIDFDAIDGAPVDLLFVLLVPQAATDAHLELLRQ
IASMLDRKDVRDKLRSAKSNEALYQVVLDEQNGQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory