SitesBLAST
Comparing GFF875 FitnessBrowser__psRCH2:GFF875 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jlwA Crystal structure of formaldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
44% identity, 96% coverage: 2:365/379 of query aligns to 3:380/395 of 4jlwA
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), D168 (= D159), T172 (= T163), G194 (= G185), P195 (= P186), V196 (= V187), D216 (= D207), R221 (= R212), V261 (= V251), R266 (≠ D257), H268 (= H259), V281 (≠ T267), P298 (≠ V284), L300 (= L286), Q336 (= Q322), T337 (≠ A323)
- binding zinc ion: C45 (= C38), H66 (= H59), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), D168 (= D159)
P46154 Glutathione-independent formaldehyde dehydrogenase; FALDH; FDH; Formaldehyde dismutase; EC 1.2.1.46; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
42% identity, 96% coverage: 2:365/379 of query aligns to 5:382/399 of P46154
1kolA Crystal structure of formaldehyde dehydrogenase (see paper)
42% identity, 96% coverage: 2:365/379 of query aligns to 3:380/396 of 1kolA
- active site: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), H66 (= H59), E67 (= E60), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), N114 (= N107), D168 (= D159), T172 (= T163)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), F92 (= F85), D168 (= D159), T172 (= T163), G192 (= G183), G194 (= G185), P195 (= P186), V196 (= V187), D216 (= D207), L217 (≠ D208), R221 (= R212), A260 (≠ C250), V261 (= V251), R266 (≠ D257), H268 (= H259), V281 (≠ T267), P298 (≠ V284), L300 (= L286), Q336 (= Q322), T337 (≠ A323)
- binding zinc ion: C45 (= C38), H66 (= H59), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), D168 (= D159)
Sites not aligning to the query:
2dphA Crystal structure of formaldehyde dismutase
39% identity, 96% coverage: 2:364/379 of query aligns to 4:380/398 of 2dphA
- active site: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), H66 (= H59), E67 (= E60), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), L114 (vs. gap), S168 (= S158), D169 (= D159), P172 (= P162)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), F92 (= F85), D169 (= D159), T173 (= T163), A192 (≠ Y182), G193 (= G183), G195 (= G185), P196 (= P186), V197 (= V187), G216 (≠ I206), D217 (= D207), Q218 (≠ D208), R222 (= R212), L236 (≠ S226), V262 (= V251), H267 (≠ C256), P298 (≠ V284), G299 (= G285), I300 (≠ L286), A337 (= A323)
- binding zinc ion: C45 (= C38), H66 (= H59), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), D169 (= D159)
Sites not aligning to the query:
Q52078 Formaldehyde dismutase; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
39% identity, 96% coverage: 2:364/379 of query aligns to 5:381/399 of Q52078
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:399 modified: mature protein, Formaldehyde dismutase
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
34% identity, 99% coverage: 1:376/379 of query aligns to 1:346/346 of 4cpdA
- active site: C38 (= C38), G39 (= G39), S40 (= S40), H43 (= H43), H59 (= H59), E60 (= E60), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), G107 (≠ A113), D152 (= D159), T156 (= T163), K340 (≠ W370)
- binding nicotinamide-adenine-dinucleotide: G39 (= G39), S40 (= S40), T156 (= T163), G178 (= G185), P179 (= P186), V180 (= V187), D200 (= D207), R201 (≠ D208), R205 (= R212), A243 (≠ C250), V244 (= V251), V266 (= V284), V268 (≠ L286), L292 (≠ Q322), A293 (= A323), F333 (= F363)
- binding zinc ion: C38 (= C38), H59 (= H59), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), D152 (= D159)
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
32% identity, 99% coverage: 1:376/379 of query aligns to 5:342/348 of 5ylnA
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
30% identity, 94% coverage: 3:360/379 of query aligns to 5:340/357 of 7y9pA
2ouiA D275p mutant of alcohol dehydrogenase from protozoa entamoeba histolytica (see paper)
37% identity, 59% coverage: 25:246/379 of query aligns to 24:238/360 of 2ouiA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H59), E60 (= E60), D89 (≠ G90), E92 (= E93), S95 (≠ G98), S103 (= S110), D150 (= D159), T154 (= T163)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D159)
Sites not aligning to the query:
P35630 NADP-dependent isopropanol dehydrogenase; EhADH1; EC 1.1.1.80 from Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) (see paper)
37% identity, 59% coverage: 25:246/379 of query aligns to 30:244/366 of P35630
- C43 (= C38) binding
- H65 (= H59) binding
- E66 (= E60) binding
- D156 (= D159) binding
1y9aA Alcohol dehydrogenase from entamoeba histolotica in complex with cacodylate (see paper)
37% identity, 59% coverage: 25:246/379 of query aligns to 24:238/360 of 1y9aA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H59), E60 (= E60), D89 (≠ G90), E92 (= E93), S95 (≠ G98), S103 (= S110), D150 (= D159), T154 (= T163)
- binding acetate ion: P24 (= P25), G69 (= G69), S70 (≠ A70)
- binding cacodylate ion: S39 (= S40), H59 (= H59), W110 (≠ F117), D150 (= D159)
- binding 1,2-ethanediol: G98 (= G101), Y99 (= Y102), M101 (≠ L104), H157 (= H166)
- binding zinc ion: C37 (= C38), D51 (≠ F51), H53 (≠ T53), H59 (= H59), D150 (= D159)
Sites not aligning to the query:
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
30% identity, 93% coverage: 25:376/379 of query aligns to 29:348/348 of O58389
- C42 (= C38) binding
- T44 (≠ S40) mutation to A: Total loss of enzymatic activity.
- H67 (= H59) binding
- E68 (= E60) binding
- C97 (= C89) binding
- C100 (= C92) binding
- C103 (= C95) binding
- C111 (= C103) binding
- E152 (≠ D159) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ V187) binding
- E199 (≠ D207) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R212) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ VGL 284:286) binding
- IT 291:292 (≠ TG 320:321) binding
- R294 (≠ A323) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
30% identity, 93% coverage: 25:376/379 of query aligns to 27:346/346 of 2dfvA
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (= H43), H65 (= H59), E66 (= E60), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), K113 (≠ N107), P151 (= P162), A155 (≠ H166), K340 (≠ W370)
- binding nicotinamide-adenine-dinucleotide: G175 (= G185), P176 (= P186), L177 (≠ V187), E197 (≠ D207), P198 (≠ D208), R202 (= R212), F241 (≠ C250), S242 (≠ V251), A244 (≠ Y253), L264 (≠ V284), G265 (= G285), L266 (= L286), I289 (≠ T320), T290 (≠ G321)
- binding zinc ion: C95 (= C89), C101 (= C95), C109 (= C103)
6schC Nadh-dependent variant of cbadh (see paper)
34% identity, 59% coverage: 23:246/379 of query aligns to 18:238/355 of 6schC
- active site: C37 (= C38), S39 (= S40), H42 (= H43), H59 (= H59), D150 (= D159)
- binding nicotinamide-adenine-dinucleotide: T38 (≠ G39), W110 (≠ F117), D150 (= D159), T154 (= T163), G174 (= G183), V178 (= V187), D198 (= D207), Y199 (≠ D208), R200 (≠ Q209)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D159)
Sites not aligning to the query:
3fplA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of c. Beijerinckii adh by t. Brockii adh (see paper)
34% identity, 59% coverage: 23:245/379 of query aligns to 18:237/351 of 3fplA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H59), E60 (= E60), D89 (≠ C89), S92 (≠ C92), V95 (≠ C95), S103 (= S110), D150 (= D159), T154 (= T163)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D159)
Sites not aligning to the query:
7xy9A Cryo-em structure of secondary alcohol dehydrogenases tbsadh after carrier-free immobilization based on weak intermolecular interactions
34% identity, 58% coverage: 25:245/379 of query aligns to 25:238/344 of 7xy9A
Sites not aligning to the query:
1kevA Structure of NADP-dependent alcohol dehydrogenase (see paper)
34% identity, 59% coverage: 23:246/379 of query aligns to 18:238/351 of 1kevA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H59), E60 (= E60), D89 (≠ C89), S92 (≠ C92), V95 (≠ C95), S103 (= S110), D150 (= D159), T154 (= T163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T38 (≠ G39), D150 (= D159), I175 (≠ A184), G176 (= G185), V178 (= V187), S199 (≠ D208), R200 (≠ Q209), Y218 (≠ S226)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D159)
Sites not aligning to the query:
P25984 NADP-dependent isopropanol dehydrogenase; CbADH; EC 1.1.1.80 from Clostridium beijerinckii (Clostridium MP) (see 3 papers)
34% identity, 59% coverage: 23:246/379 of query aligns to 18:238/351 of P25984
Sites not aligning to the query:
- 265:267 binding
- 340 binding
7ux4A Crystallographic snapshots of ternary complexes of thermophilic secondary alcohol dehydrogenase from thermoanaerobacter pseudoethanolicus reveal the dynamics of ligand exchange and the proton relay network. (see paper)
28% identity, 93% coverage: 25:377/379 of query aligns to 22:339/350 of 7ux4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D148 (= D159), T152 (= T163), G172 (= G183), I173 (≠ A184), G174 (= G185), P175 (= P186), V176 (= V187), R198 (≠ Q209), G242 (= G252), V263 (= V284), N264 (≠ G285), Y265 (≠ L286), C293 (≠ I318)
- binding (1S,3S)-3-methylcyclohexan-1-ol: S37 (= S40), H57 (= H59), W108 (≠ F117), D148 (= D159)
- binding zinc ion: C35 (= C38), H57 (= H59), E58 (= E60), D148 (= D159)
7uutA Ternary complex crystal structure of secondary alcohol dehydrogenases from the thermoanaerobacter ethanolicus mutants c295a and i86a provides better understanding of catalytic mechanism (see paper)
28% identity, 93% coverage: 25:377/379 of query aligns to 24:341/352 of 7uutA
- binding (2R)-pentan-2-ol: S39 (= S40), H59 (= H59), A85 (≠ F85), W110 (≠ F117), D150 (= D159), C295 (≠ I318)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C37 (= C38), T38 (≠ G39), S39 (= S40), D150 (= D159), T154 (= T163), G174 (= G183), G176 (= G185), P177 (= P186), V178 (= V187), S199 (≠ D208), R200 (≠ Q209), A242 (≠ C250), G243 (≠ V251), G244 (= G252), I248 (≠ T267), V265 (= V284), N266 (≠ G285), Y267 (≠ L286), C295 (≠ I318), K340 (= K376)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D159)
Query Sequence
>GFF875 FitnessBrowser__psRCH2:GFF875
MKAIVYNGPRDVSVQNVPDAKIERPTDALVRVTSTNICGSDLHMYEGRTTFETGRVFGHE
NLGEVVEVGAGVERVKVGDMVCLPFNIGCGFCENCEKGLTGYCLTANPGSAGAAYGFAEM
GTYDGGQAELLRVPFADFNCLVLPEDAKEREDDYVMLSDIFPTGWHATRLAGLQPGESIA
IYGAGPVGLMAAHSALIQGASQVFVIDDQPDRLKLAAQMGATPINSVEQKAVDEILNYTD
GKGTDRGCECVGYQCCDKHGHEVNHLTMNNLVASTKATGGIGVVGLFVPQDPGAKNELAK
EGKMAFDFGSFWFKGQKIGTGQANVKAYNRQLAELIHHGRAAPSQIVSHRLKLDDGPSAY
KHFDARDKGWTKVVMKPAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory