SitesBLAST
Comparing GFF878 FitnessBrowser__Marino:GFF878 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yu6B Crystal structure of mhst in complex with l-leucine (see paper)
45% identity, 96% coverage: 15:456/460 of query aligns to 5:438/446 of 6yu6B
6yu5A Crystal structure of mhst in complex with l-valine (see paper)
45% identity, 97% coverage: 12:456/460 of query aligns to 2:438/441 of 6yu5A
6yu3A Crystal structure of mhst in complex with l-phenylalanine (see paper)
45% identity, 97% coverage: 12:456/460 of query aligns to 2:438/441 of 6yu3A
6yu2A Crystal structure of mhst in complex with l-isoleucine (see paper)
45% identity, 97% coverage: 12:456/460 of query aligns to 2:438/441 of 6yu2A
4us3A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (see paper)
45% identity, 97% coverage: 12:456/460 of query aligns to 2:438/441 of 4us3A
- binding sodium ion: G17 (= G27), A19 (= A29), V20 (= V30), V20 (= V30), G21 (= G31), N24 (= N34), T224 (= T237), D256 (= D269), A313 (= A326), S316 (≠ T329), S317 (= S330)
- binding tryptophan: S18 (= S28), A19 (= A29), L22 (= L32), G23 (= G33), Y101 (= Y115), F223 (= F236), T224 (= T237), S226 (= S239), M229 (≠ I242), S320 (= S333), L321 (≠ M334)
6yu7A Crystal structure of mhst in complex with l-tyrosine (see paper)
45% identity, 97% coverage: 12:456/460 of query aligns to 2:438/442 of 6yu7A
6yu4A Crystal structure of mhst in complex with l-4f-phenylalanine (see paper)
45% identity, 97% coverage: 12:456/460 of query aligns to 2:438/442 of 6yu4A
- binding 4-fluoro-l-phenylalanine: S18 (= S28), A19 (= A29), G21 (= G31), L22 (= L32), G23 (= G33), Y101 (= Y115), F223 (= F236), T224 (= T237), S226 (= S239), M229 (≠ I242), L321 (≠ M334)
4us4A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (lipidic cubic phase form) (see paper)
45% identity, 95% coverage: 21:456/460 of query aligns to 2:429/433 of 4us4A
- binding (2s)-2,3-dihydroxypropyl(7z)-pentadec-7-enoate: A173 (= A196), T180 (≠ N203), I287 (≠ M309), R288 (≠ S310), L289 (≠ G311)
- binding sodium ion: G8 (= G27), S9 (= S28), A10 (= A29), V11 (= V30), V11 (= V30), N15 (= N34), T215 (= T237), D247 (= D269), A304 (= A326), S307 (≠ T329), S308 (= S330)
- binding tryptophan: S9 (= S28), A10 (= A29), G12 (= G31), G14 (= G33), Y92 (= Y115), F214 (= F236), T215 (= T237), S217 (= S239), M220 (≠ I242), L312 (≠ M334)
3gwwA Leucine transporter leut in complex with s-fluoxetine (see paper)
29% identity, 96% coverage: 15:454/460 of query aligns to 4:454/501 of 3gwwA
- binding leucine: A18 (= A29), G20 (= G31), G22 (= G33), Y104 (= Y115), F244 (= F236), T245 (= T237), S247 (= S239), F250 (≠ I242), I350 (≠ M334)
- binding (3S)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L32), G22 (= G33), R26 (≠ K37), Y104 (= Y115), A310 (≠ G294), F311 (≠ P295), D392 (= D394), D395 (= D397)
3f3aA Crystal structure of leut bound to l-tryptophan and sodium (see paper)
30% identity, 96% coverage: 15:454/460 of query aligns to 4:456/504 of 3f3aA
- binding sodium ion: G16 (= G27), N17 (≠ S28), A18 (= A29), V19 (= V30), V19 (= V30), G20 (= G31), N23 (= N34), T247 (= T237), N279 (≠ D269), A344 (= A326), T347 (= T329), S348 (= S330)
- binding tryptophan: R7 (= R18), A18 (= A29), G20 (= G31), L21 (= L32), G22 (= G33), R26 (≠ K37), Y104 (= Y115), G242 (= G232), F246 (= F236), F246 (= F236), T247 (= T237), S249 (= S239), F252 (≠ I242), D265 (≠ T255), Q266 (≠ V256), D267 (≠ N257), F299 (= F281), N303 (≠ F285), A306 (≠ G288), I307 (≠ L289), A310 (≠ G292), N314 (≠ G296), S348 (= S330), I352 (≠ M334), D397 (= D397), G401 (≠ S401), T402 (≠ N402), G432 (≠ Q432)
3mpnA F177r1 mutant of leut (see paper)
29% identity, 96% coverage: 15:456/460 of query aligns to 4:459/505 of 3mpnA
- binding leucine: N17 (≠ S28), A18 (= A29), G20 (= G31), L21 (= L32), G22 (= G33), Y104 (= Y115), F247 (= F236), T248 (= T237), S250 (= S239), F253 (≠ I242), S349 (= S330)
- binding S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate: C171 (≠ V165), A377 (≠ G358)
3uslA Crystal structure of leut bound to l-selenomethionine in space group c2 from lipid bicelles (see paper)
30% identity, 96% coverage: 15:454/460 of query aligns to 4:456/502 of 3uslA
- binding selenomethionine: A18 (= A29), G20 (= G31), G22 (= G33), Y104 (= Y115), F246 (= F236), T247 (= T237), S249 (= S239), S348 (= S330), I352 (≠ M334)
- binding sodium ion: G16 (= G27), N17 (≠ S28), A18 (= A29), V19 (= V30), V19 (= V30), G20 (= G31), N23 (= N34), T247 (= T237), N279 (≠ D269), A344 (= A326), T347 (= T329), S348 (= S330)
- binding phosphocholine: N83 (≠ A94), R84 (= R95), F85 (≠ G96)
3usgA Crystal structure of leut bound to l-leucine in space group c2 from lipid bicelles (see paper)
30% identity, 96% coverage: 15:454/460 of query aligns to 4:456/502 of 3usgA
- binding leucine: A18 (= A29), G20 (= G31), G22 (= G33), F246 (= F236), T247 (= T237), S249 (= S239), F252 (≠ I242)
- binding sodium ion: G16 (= G27), N17 (≠ S28), A18 (= A29), V19 (= V30), V19 (= V30), G20 (= G31), N23 (= N34), T247 (= T237), N279 (≠ D269), A344 (= A326), T347 (= T329), S348 (= S330)
- binding phosphocholine: N83 (≠ A94), R84 (= R95)
3gwvA Leucine transporter leut in complex with r-fluoxetine (see paper)
29% identity, 96% coverage: 15:454/460 of query aligns to 4:457/498 of 3gwvA
- binding leucine: A18 (= A29), G20 (= G31), G22 (= G33), Y104 (= Y115), F247 (= F236), T248 (= T237), S250 (= S239), F253 (≠ I242)
- binding (3R)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L32), R26 (≠ K37), A313 (≠ G294), F314 (≠ P295), L394 (≠ F393), D395 (= D394), D398 (= D397)
2qeiA Crystal structure analysis of leut complexed with l-alanine, sodium, and clomipramine (see paper)
29% identity, 96% coverage: 15:456/460 of query aligns to 5:460/511 of 2qeiA
- binding alanine: A19 (= A29), G21 (= G31), G23 (= G33), Y105 (= Y115), F248 (= F236), T249 (= T237), S251 (= S239)
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K37), V30 (≠ Y40), Q31 (≠ I41), Y104 (≠ F114), R180 (= R173), R188 (≠ K181), F189 (≠ A182), F315 (≠ P295), F345 (≠ V325), D396 (= D394), D399 (= D397)
- binding sodium ion: G17 (= G27), A19 (= A29), V20 (= V30), V20 (= V30), G21 (= G31), N24 (= N34), T249 (= T237), N281 (≠ D269), A346 (= A326), T349 (= T329), S350 (= S330)
2q72A Crystal structure analysis of leut complexed with l-leucine, sodium, and imipramine (see paper)
29% identity, 96% coverage: 15:456/460 of query aligns to 5:460/511 of 2q72A
- binding 3-(5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K37), V30 (≠ Y40), Q31 (≠ I41), R188 (≠ K181), F189 (≠ A182), I192 (≠ M185), A314 (≠ G294), F315 (≠ P295), F345 (≠ V325), D396 (= D394)
- binding leucine: A19 (= A29), G21 (= G31), L22 (= L32), G23 (= G33), Y105 (= Y115), F248 (= F236), T249 (= T237), S251 (= S239), F254 (≠ I242)
- binding sodium ion: G17 (= G27), A19 (= A29), V20 (= V30), V20 (= V30), G21 (= G31), N24 (= N34), T249 (= T237), N281 (≠ D269), A346 (= A326), T349 (= T329), S350 (= S330)
3gwuA Leucine transporter leut in complex with sertraline (see paper)
29% identity, 96% coverage: 15:456/460 of query aligns to 4:459/509 of 3gwuA
- binding leucine: A18 (= A29), G20 (= G31), G22 (= G33), Y104 (= Y115), F247 (= F236), T248 (= T237), S250 (= S239), F253 (≠ I242)
- binding (1S,4S)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine: L25 (≠ W36), R26 (≠ K37), Y104 (= Y115), F247 (= F236), A313 (≠ G294), D395 (= D394), D398 (= D397)
3f4jA Crystal structure of leut bound to glycine and sodium (see paper)
29% identity, 96% coverage: 15:456/460 of query aligns to 4:459/509 of 3f4jA
- binding glycine: A18 (= A29), G20 (= G31), G22 (= G33), Y104 (= Y115), F247 (= F236), T248 (= T237), S250 (= S239)
- binding sodium ion: G16 (= G27), A18 (= A29), V19 (= V30), V19 (= V30), G20 (= G31), G22 (= G33), N23 (= N34), T248 (= T237), N280 (≠ D269), A345 (= A326), G346 (≠ A327), T348 (= T329), S349 (= S330)
3f3dA Crystal structure of leut bound to l-methionine and sodium (see paper)
29% identity, 96% coverage: 15:456/460 of query aligns to 4:459/509 of 3f3dA
- binding methionine: N17 (≠ S28), A18 (= A29), G20 (= G31), G22 (= G33), Y104 (= Y115), F247 (= F236), T248 (= T237), S250 (= S239), S349 (= S330), I353 (≠ M334)
- binding sodium ion: G16 (= G27), A18 (= A29), V19 (= V30), V19 (= V30), G20 (= G31), N23 (= N34), T248 (= T237), N280 (≠ D269), A345 (= A326), T348 (= T329), S349 (= S330)
3f3cA Crystal structure of leut bound to 4-fluoro-l-phenylalanine and sodium (see paper)
29% identity, 96% coverage: 15:456/460 of query aligns to 4:459/509 of 3f3cA
- binding sodium ion: G16 (= G27), A18 (= A29), V19 (= V30), V19 (= V30), G20 (= G31), N23 (= N34), T248 (= T237), N280 (≠ D269), A345 (= A326), T348 (= T329), S349 (= S330)
- binding 4-fluoro-l-phenylalanine: N17 (≠ S28), A18 (= A29), G20 (= G31), G22 (= G33), Y104 (= Y115), F247 (= F236), T248 (= T237), S250 (= S239), F253 (≠ I242), S349 (= S330), I353 (≠ M334)
Query Sequence
>GFF878 FitnessBrowser__Marino:GFF878
MSESTQPHQQANNLWSSRMAFILAAAGSAVGLGNIWKFPYITGENGGGAFVLIYLACIFL
IGVPVLIAETMIGRRGGQSPVATMRTLTKTEGTARGWRAIGWNGVIASFLVLSFYAVIGG
WALVYIGKAATGLFTGADAEAIGGQFGGLLANPWELLMWHSVFMVIVVFIVGRGIRSGLE
KAVNMLMPLLFVLLVAMVIYAMNSGSFGRAVSFMFSPDFSKLTTAGVLTALGHAAFTLSI
GIGVLMAYGSYLPKTVNIARTAMTIAVVDTSVALLAGLAIFPLVFANGLEPGAGPGLIFV
TLPLAFGQMSGGALFGTIFFALLLVAAITSAISMLEPVVEWLEEHKGVSRAKSAIGGGLA
IWFIGIGTVLSFNVWESVHPLGFIPFFEGKTVFDLLDFLVSNLMMPLGGLAIALFAGWAM
KRESLPADIGLQGSSYKAFMFVLRYLTPAGIAVVFLYNLL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory