SitesBLAST
Comparing GFF974 FitnessBrowser__Marino:GFF974 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6a50A Structure of benzoylformate decarboxylases in complex with cofactor tpp
28% identity, 90% coverage: 16:513/552 of query aligns to 16:520/527 of 6a50A
- binding magnesium ion: N117 (≠ T118), L118 (≠ V119), R120 (= R121), D428 (= D414), N455 (= N441), T457 (≠ S443)
- binding thiamine diphosphate: N23 (= N23), P24 (= P24), E47 (= E49), H70 (= H72), T377 (≠ I363), S378 (vs. gap), G401 (= G386), L403 (≠ I389), G427 (= G413), D428 (= D414), G429 (= G415), S430 (≠ T416), Y433 (= Y419), N455 (= N441), T457 (≠ S443), Y458 (= Y444), G459 (≠ S445), M460 (≠ V446), L461 (= L447)
3fznA Intermediate analogue in benzoylformate decarboxylase (see paper)
28% identity, 90% coverage: 16:513/552 of query aligns to 15:519/523 of 3fznA
- active site: N22 (= N23), G24 (= G25), S25 (≠ T26), N26 (≠ S27), E27 (= E28), E46 (= E49), H69 (= H72), L108 (≠ Q111), L109 (= L112), T110 (≠ Q113), N111 (≠ S114), Y159 (≠ A162), P253 (≠ Y253), H280 (≠ F280), S375 (≠ G362), G400 (= G386), L402 (≠ I389), D427 (= D414), N454 (= N441), T456 (≠ S443), Y457 (= Y444), A459 (≠ V446), L460 (= L447), F463 (≠ E450)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(S)-hydroxy[(R)-hydroxy(methoxy)phosphoryl]phenylmethyl}-5-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: N22 (= N23), P23 (= P24), G24 (= G25), S25 (≠ T26), E46 (= E49), H69 (= H72), H280 (≠ F280), T376 (≠ I363), S377 (vs. gap), G400 (= G386), L402 (≠ I389), G426 (= G413), D427 (= D414), G428 (= G415), S429 (≠ T416), Y432 (= Y419), N454 (= N441), T456 (≠ S443), Y457 (= Y444), G458 (≠ S445), A459 (≠ V446)
- binding magnesium ion: D427 (= D414), N454 (= N441), T456 (≠ S443)
- binding phosphate ion: Q286 (≠ K285), L288 (= L289), K289 (≠ V290), P290 (= P291)
1bfdA Benzoylformate decarboxylase from pseudomonas putida (see paper)
28% identity, 90% coverage: 16:513/552 of query aligns to 15:519/523 of 1bfdA
- active site: N22 (= N23), G24 (= G25), S25 (≠ T26), N26 (≠ S27), E27 (= E28), E46 (= E49), H69 (= H72), L108 (≠ Q111), L109 (= L112), T110 (≠ Q113), N111 (≠ S114), Y159 (≠ A162), P253 (≠ Y253), H280 (≠ F280), S375 (≠ G362), G400 (= G386), L402 (≠ I389), D427 (= D414), N454 (= N441), T456 (≠ S443), Y457 (= Y444), A459 (≠ V446), L460 (= L447), F463 (≠ E450)
- binding calcium ion: D427 (= D414), N454 (= N441), T456 (≠ S443)
- binding magnesium ion: N116 (≠ T118), L117 (≠ V119), R119 (= R121)
- binding thiamine diphosphate: T376 (≠ I363), S377 (vs. gap), L402 (≠ I389), G426 (= G413), D427 (= D414), G428 (= G415), S429 (≠ T416), Y432 (= Y419), T456 (≠ S443), Y457 (= Y444), G458 (≠ S445), A459 (≠ V446), L460 (= L447)
3f6bX Crystal structure of benzoylformate decarboxylase in complex with the pyridyl inhibitor paa (see paper)
28% identity, 90% coverage: 16:513/552 of query aligns to 15:519/525 of 3f6bX
- active site: G24 (= G25), E46 (= E49), L108 (≠ Q111), L109 (= L112), T110 (≠ Q113), N111 (≠ S114), G400 (= G386), D427 (= D414), N454 (= N441), T456 (≠ S443), Y457 (= Y444), A459 (≠ V446), L460 (= L447)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-2-[(1S,2E)-1-hydroxy-3-pyridin-3-ylprop-2-en-1-yl]-4-methyl-1,3-thiazol-3-ium: N22 (= N23), P23 (= P24), G24 (= G25), S25 (≠ T26), E46 (= E49), H69 (= H72)
Sites not aligning to the query:
5deiA Benzoylformate decarboxylase from pseudomonas putida
28% identity, 90% coverage: 16:513/552 of query aligns to 15:519/524 of 5deiA
- active site: N22 (= N23), G24 (= G25), S25 (≠ T26), N26 (≠ S27), E27 (= E28), E46 (= E49), H69 (= H72), L108 (≠ Q111), L109 (= L112), T110 (≠ Q113), N111 (≠ S114), Y159 (≠ A162), P253 (≠ Y253), H280 (≠ F280), S375 (≠ G362), G400 (= G386), L402 (≠ I389), D427 (= D414), N454 (= N441), T456 (≠ S443), Y457 (= Y444), A459 (≠ V446), L460 (= L447), F463 (≠ E450)
- binding bicarbonate ion: S25 (≠ T26), H69 (= H72), L109 (= L112)
- binding calcium ion: N185 (≠ D185), D186 (= D186), D427 (= D414), N454 (= N441), T456 (≠ S443)
- binding magnesium ion: N116 (≠ T118), L117 (≠ V119), R119 (= R121)
- binding thiamine diphosphate: N22 (= N23), P23 (= P24), E46 (= E49), H69 (= H72), T376 (≠ I363), S377 (vs. gap), L402 (≠ I389), G426 (= G413), D427 (= D414), G428 (= G415), S429 (≠ T416), Y432 (= Y419), T456 (≠ S443), Y457 (= Y444), G458 (≠ S445), A459 (≠ V446), L460 (= L447)
Sites not aligning to the query:
3fsjX Crystal structure of benzoylformate decarboxylase in complex with the inhibitor mbp (see paper)
28% identity, 90% coverage: 16:513/552 of query aligns to 15:519/524 of 3fsjX
- active site: G24 (= G25), S25 (≠ T26), E27 (= E28), E46 (= E49), H69 (= H72), L108 (≠ Q111), L109 (= L112), T110 (≠ Q113), N111 (≠ S114), H280 (≠ F280), G400 (= G386), D427 (= D414), N454 (= N441), T456 (≠ S443), Y457 (= Y444), A459 (≠ V446), L460 (= L447)
- binding calcium ion: D427 (= D414), N454 (= N441), T456 (≠ S443)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(S)-hydroxy[(R)-hydroxy(methoxy)phosphoryl]phenylmethyl}-5-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: H280 (≠ F280), T376 (≠ I363), S377 (vs. gap), F396 (≠ I382), G400 (= G386), L402 (≠ I389), G426 (= G413), D427 (= D414), G428 (= G415), S429 (≠ T416), Y432 (= Y419), T456 (≠ S443), Y457 (= Y444), G458 (≠ S445), A459 (≠ V446), L460 (= L447), F463 (≠ E450)
Sites not aligning to the query:
1mczA Benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate (see paper)
28% identity, 90% coverage: 16:513/552 of query aligns to 15:519/524 of 1mczA
- active site: N22 (= N23), G24 (= G25), S25 (≠ T26), N26 (≠ S27), E27 (= E28), E46 (= E49), H69 (= H72), L108 (≠ Q111), L109 (= L112), T110 (≠ Q113), N111 (≠ S114), Y159 (≠ A162), P253 (≠ Y253), H280 (≠ F280), S375 (≠ G362), G400 (= G386), L402 (≠ I389), D427 (= D414), N454 (= N441), T456 (≠ S443), Y457 (= Y444), A459 (≠ V446), L460 (= L447), F463 (≠ E450)
- binding magnesium ion: N116 (≠ T118), L117 (≠ V119), R119 (= R121), D427 (= D414), N454 (= N441), T456 (≠ S443)
- binding (r)-mandelic acid: S25 (≠ T26), H69 (= H72), L109 (= L112), H280 (≠ F280), T376 (≠ I363), F463 (≠ E450)
- binding thiamine diphosphate: N22 (= N23), P23 (= P24), E46 (= E49), H69 (= H72), T376 (≠ I363), S377 (vs. gap), G400 (= G386), L402 (≠ I389), G426 (= G413), D427 (= D414), G428 (= G415), S429 (≠ T416), Y432 (= Y419), Y457 (= Y444), G458 (≠ S445), A459 (≠ V446), L460 (= L447)
Sites not aligning to the query:
1pi3A E28q mutant benzoylformate decarboxylase from pseudomonas putida
28% identity, 90% coverage: 16:513/552 of query aligns to 15:519/523 of 1pi3A
- active site: N22 (= N23), G24 (= G25), S25 (≠ T26), N26 (≠ S27), Q27 (≠ E28), E46 (= E49), H69 (= H72), L108 (≠ Q111), L109 (= L112), T110 (≠ Q113), N111 (≠ S114), Y159 (≠ A162), P253 (≠ Y253), H280 (≠ F280), S375 (≠ G362), G400 (= G386), L402 (≠ I389), D427 (= D414), N454 (= N441), T456 (≠ S443), Y457 (= Y444), A459 (≠ V446), L460 (= L447), F463 (≠ E450)
- binding calcium ion: D427 (= D414), N454 (= N441), T456 (≠ S443)
- binding magnesium ion: N116 (≠ T118), L117 (≠ V119), R119 (= R121)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: T376 (≠ I363), S377 (vs. gap), L402 (≠ I389), G426 (= G413), G428 (= G415), S429 (≠ T416), Y432 (= Y419), N454 (= N441), T456 (≠ S443), Y457 (= Y444), G458 (≠ S445), A459 (≠ V446), L460 (= L447)
6qsiA Pseudomonas fluorescens pf-5 thiamine diphosphate-dependent 4- hydroxybenzoylformate decarboxylase (see paper)
27% identity, 92% coverage: 7:513/552 of query aligns to 6:519/525 of 6qsiA
- active site: N22 (= N23), G24 (= G25), S25 (≠ T26), N26 (≠ S27), E27 (= E28), E46 (= E49), H69 (= H72), M108 (≠ Q111), L109 (= L112), A110 (≠ Q113), Y159 (≠ A162), P253 (= P246), H280 (≠ A281), S375 (≠ G362), G400 (= G386), L402 (≠ I389), Y457 (= Y444), A459 (≠ V446), L460 (= L447), F463 (≠ E450)
- binding thiamine diphosphate: N22 (= N23), P23 (= P24), E46 (= E49), H69 (= H72), T376 (≠ I363), S377 (vs. gap), L402 (≠ I389), G426 (= G413), G428 (= G415), S429 (≠ T416), Y432 (= Y419), N454 (= N441), T456 (≠ S443), Y457 (= Y444), G458 (≠ S445), A459 (≠ V446), L460 (= L447)
4q9dB X-ray structure of a putative thiamin diphosphate-dependent enzyme isolated from mycobacterium smegmatis (see paper)
25% identity, 90% coverage: 16:512/552 of query aligns to 17:513/519 of 4q9dB
- active site: N24 (= N23), G26 (= G25), S27 (≠ T26), T28 (≠ S27), E29 (= E28), Q47 (≠ F48), E48 (= E49), H71 (= H72), V107 (≠ Y108), D108 (= D109), Y110 (≠ Q111), L111 (= L112), N112 (≠ Q113), N113 (≠ S114), L161 (≠ A162), P252 (≠ Y253), Y279 (≠ F280), M374 (≠ D360), S376 (≠ T364), G401 (= G387), I403 (= I389), D432 (= D414), N459 (= N441), E461 (≠ S443), Y462 (= Y444), I464 (≠ V446)
- binding magnesium ion: D432 (= D414), N459 (= N441), E461 (≠ S443)
Sites not aligning to the query:
4k9qA The crystal structure of benzoylformate decarboxylase from polynucleobacter necessarius
25% identity, 91% coverage: 17:520/552 of query aligns to 17:528/531 of 4k9qA
- active site: N23 (= N23), G25 (= G25), S26 (≠ T26), T27 (≠ S27), E28 (= E28), E47 (= E49), H70 (= H72), N106 (≠ D109), E107 (≠ A110), L110 (≠ Q113), T111 (≠ S114), L160 (≠ A162), T251 (= T259), Y278 (= Y282), V370 (= V359), C373 (≠ G362), G398 (= G387), L400 (≠ I389), D429 (= D414), N456 (= N441), E458 (≠ S443), Y459 (= Y444), G460 (≠ S445), I461 (≠ V446), L462 (= L447), F465 (≠ G455), K526 (≠ E518)
- binding magnesium ion: D429 (= D414), N456 (= N441), E458 (≠ S443)
- binding thiamine diphosphate: P374 (≠ I363), S375 (≠ T364), L400 (≠ I389), G428 (= G413), D429 (= D414), G430 (= G415), S431 (≠ T416), Y434 (= Y419), N456 (= N441), E458 (≠ S443), Y459 (= Y444), G460 (≠ S445), I461 (≠ V446), L462 (= L447)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
25% identity, 95% coverage: 4:529/552 of query aligns to 14:564/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ I248), R292 (≠ P276), W489 (≠ I449)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ I363), G401 (≠ T364), Q402 (≠ S365), H403 (≠ S366), G426 (= G387), M428 (≠ I389), G452 (= G413), D453 (= D414), G454 (= G415), S455 (≠ T416), L483 (≠ Y444), G484 (≠ S445), M485 (vs. gap), V486 (= V446)
- binding flavin-adenine dinucleotide: R161 (= R149), G222 (= G207), G223 (= G208), G224 (≠ H209), T246 (= T229), L247 (= L230), M248 (≠ L231), M263 (≠ L245), L264 (≠ P246), M266 (≠ I248), H267 (≠ E249), G286 (≠ L270), R288 (≠ D272), V293 (= V277), D310 (≠ V290), I311 (≠ P291), D329 (= D305), V330 (≠ I306), M405 (= M368), G423 (≠ L384)
- binding magnesium ion: A37 (≠ S27), T82 (≠ H72), S83 (≠ L73), Q122 (≠ L112), Y381 (vs. gap), D453 (= D414), M458 (≠ Y419), Q461 (= Q422), N480 (= N441), H482 (≠ S443), K533 (≠ A493)
Sites not aligning to the query:
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
25% identity, 95% coverage: 4:529/552 of query aligns to 14:564/583 of 5k3sA
- active site: Y33 (≠ N23), G35 (= G25), G36 (≠ T26), A37 (≠ S27), S38 (≠ E28), E59 (= E49), T82 (≠ H72), F121 (≠ Q111), Q122 (≠ L112), E123 (≠ Q113), K171 (≠ A162), M266 (≠ I248), V293 (= V277), V400 (≠ I363), G426 (= G387), M428 (≠ I389), D453 (= D414), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), M485 (vs. gap), V486 (= V446), W489 (≠ I449), H558 (≠ E518)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (≠ P276), M485 (vs. gap), W489 (≠ I449)
- binding flavin-adenine dinucleotide: R161 (= R149), G222 (= G207), G223 (= G208), G224 (≠ H209), T246 (= T229), L247 (= L230), M248 (≠ L231), L264 (≠ P246), M266 (≠ I248), G286 (≠ L270), R288 (≠ D272), D290 (≠ K274), V293 (= V277), D310 (≠ V290), I311 (≠ P291), D329 (= D305), V330 (≠ I306), M405 (= M368), G423 (≠ L384)
- binding magnesium ion: D453 (= D414), N480 (= N441), H482 (≠ S443)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ I363), G401 (≠ T364), Q402 (≠ S365), H403 (≠ S366), G426 (= G387), M428 (≠ I389), D453 (= D414), G454 (= G415), S455 (≠ T416), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), G484 (≠ S445), M485 (vs. gap), V486 (= V446)
Sites not aligning to the query:
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
25% identity, 95% coverage: 4:529/552 of query aligns to 14:564/585 of 5k2oA
- active site: Y33 (≠ N23), G35 (= G25), G36 (≠ T26), A37 (≠ S27), S38 (≠ E28), E59 (= E49), T82 (≠ H72), F121 (≠ Q111), Q122 (≠ L112), E123 (≠ Q113), K171 (≠ A162), M266 (≠ I248), V293 (= V277), V400 (≠ I363), G426 (= G387), M428 (≠ I389), D453 (= D414), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), M485 (vs. gap), V486 (= V446), W489 (≠ I449), H558 (≠ E518)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ I248), R292 (≠ P276), W489 (≠ I449)
- binding flavin-adenine dinucleotide: R161 (= R149), G222 (= G207), G223 (= G208), G224 (≠ H209), T246 (= T229), L247 (= L230), M248 (≠ L231), L264 (≠ P246), G286 (≠ L270), R288 (≠ D272), D290 (≠ K274), V293 (= V277), D310 (≠ V290), I311 (≠ P291), D329 (= D305), V330 (≠ I306), Q404 (≠ L367), M405 (= M368), G423 (≠ L384)
- binding magnesium ion: D453 (= D414), N480 (= N441), H482 (≠ S443)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ I363), G401 (≠ T364), Q402 (≠ S365), H403 (≠ S366), M428 (≠ I389), D453 (= D414), G454 (= G415), S455 (≠ T416), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), G484 (≠ S445), M485 (vs. gap), V486 (= V446)
Sites not aligning to the query:
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
25% identity, 95% coverage: 4:529/552 of query aligns to 14:564/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ I363), G401 (≠ T364), Q402 (≠ S365), H403 (≠ S366), G426 (= G387), M428 (≠ I389), G452 (= G413), D453 (= D414), G454 (= G415), S455 (≠ T416), M458 (≠ Y419), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), G484 (≠ S445), M485 (vs. gap), V486 (= V446)
- binding flavin-adenine dinucleotide: R161 (= R149), G222 (= G207), G223 (= G208), G224 (≠ H209), T246 (= T229), L247 (= L230), M248 (≠ L231), L264 (≠ P246), M266 (≠ I248), H267 (≠ E249), G286 (≠ L270), V287 (= V271), R288 (≠ D272), D290 (≠ K274), R292 (≠ P276), V293 (= V277), D310 (≠ V290), I311 (≠ P291), D329 (= D305), V330 (≠ I306), M405 (= M368), G423 (≠ L384)
- binding magnesium ion: F370 (≠ C345), D453 (= D414), M458 (≠ Y419), Q461 (= Q422), N480 (= N441), H482 (≠ S443), K533 (≠ A493)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ I248), R292 (≠ P276), M485 (vs. gap), W489 (≠ I449)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
25% identity, 95% coverage: 4:529/552 of query aligns to 14:564/582 of 5wj1A
- active site: Y33 (≠ N23), G35 (= G25), G36 (≠ T26), A37 (≠ S27), S38 (≠ E28), E59 (= E49), T82 (≠ H72), F121 (≠ Q111), Q122 (≠ L112), E123 (≠ Q113), K171 (≠ A162), M266 (≠ I248), V293 (= V277), V400 (≠ I363), G426 (= G387), M428 (≠ I389), D453 (= D414), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), M485 (vs. gap), V486 (= V446), W489 (≠ I449), H558 (≠ E518)
- binding flavin-adenine dinucleotide: R161 (= R149), G222 (= G207), G223 (= G208), G224 (≠ H209), T246 (= T229), L247 (= L230), M248 (≠ L231), M263 (≠ L245), L264 (≠ P246), G286 (≠ L270), R288 (≠ D272), V293 (= V277), D310 (≠ V290), I311 (≠ P291), D329 (= D305), V330 (≠ I306), M405 (= M368), G423 (≠ L384), G424 (≠ T385)
- binding magnesium ion: D453 (= D414), N480 (= N441), H482 (≠ S443)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ I248), D291 (≠ A275), R292 (≠ P276), M485 (vs. gap), W489 (≠ I449)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ I363), G401 (≠ T364), Q402 (≠ S365), H403 (≠ S366), M428 (≠ I389), D453 (= D414), G454 (= G415), S455 (≠ T416), M458 (≠ Y419), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), G484 (≠ S445), M485 (vs. gap), V486 (= V446)
Sites not aligning to the query:
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
25% identity, 95% coverage: 4:529/552 of query aligns to 14:564/582 of 5k6tA
- active site: Y33 (≠ N23), G35 (= G25), G36 (≠ T26), A37 (≠ S27), S38 (≠ E28), E59 (= E49), T82 (≠ H72), F121 (≠ Q111), Q122 (≠ L112), E123 (≠ Q113), K171 (≠ A162), M266 (≠ I248), V293 (= V277), V400 (≠ I363), G426 (= G387), M428 (≠ I389), D453 (= D414), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), M485 (vs. gap), V486 (= V446), W489 (≠ I449), H558 (≠ E518)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ E249), R292 (≠ P276), M485 (vs. gap), W489 (≠ I449)
- binding flavin-adenine dinucleotide: R161 (= R149), G222 (= G207), G223 (= G208), G224 (≠ H209), T246 (= T229), L247 (= L230), M248 (≠ L231), L264 (≠ P246), G286 (≠ L270), R288 (≠ D272), D290 (≠ K274), R292 (≠ P276), V293 (= V277), D310 (≠ V290), I311 (≠ P291), D329 (= D305), V330 (≠ I306), Q404 (≠ L367), M405 (= M368), G423 (≠ L384)
- binding magnesium ion: D453 (= D414), N480 (= N441), H482 (≠ S443)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ I363), G401 (≠ T364), Q402 (≠ S365), H403 (≠ S366), G426 (= G387), M428 (≠ I389), G452 (= G413), G454 (= G415), S455 (≠ T416), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), G484 (≠ S445)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
25% identity, 95% coverage: 4:529/552 of query aligns to 14:564/582 of 5k6rA
- active site: Y33 (≠ N23), G35 (= G25), G36 (≠ T26), A37 (≠ S27), S38 (≠ E28), E59 (= E49), T82 (≠ H72), F121 (≠ Q111), Q122 (≠ L112), E123 (≠ Q113), K171 (≠ A162), M266 (≠ I248), V293 (= V277), V400 (≠ I363), G426 (= G387), M428 (≠ I389), D453 (= D414), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), M485 (vs. gap), V486 (= V446), W489 (≠ I449), H558 (≠ E518)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (≠ P276), W489 (≠ I449)
- binding flavin-adenine dinucleotide: R161 (= R149), G222 (= G207), G223 (= G208), G224 (≠ H209), T246 (= T229), L247 (= L230), M248 (≠ L231), L264 (≠ P246), M266 (≠ I248), G286 (≠ L270), R288 (≠ D272), R292 (≠ P276), V293 (= V277), D310 (≠ V290), I311 (≠ P291), G328 (≠ Q304), D329 (= D305), V330 (≠ I306), M405 (= M368), G423 (≠ L384)
- binding magnesium ion: D453 (= D414), N480 (= N441), H482 (≠ S443)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ I363), G401 (≠ T364), Q402 (≠ S365), H403 (≠ S366), G426 (= G387), M428 (≠ I389), D453 (= D414), G454 (= G415), S455 (≠ T416), M458 (≠ Y419), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), G484 (≠ S445), M485 (vs. gap), V486 (= V446)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
25% identity, 95% coverage: 4:529/552 of query aligns to 14:564/582 of 1z8nA
- active site: Y33 (≠ N23), G35 (= G25), G36 (≠ T26), A37 (≠ S27), S38 (≠ E28), E59 (= E49), T82 (≠ H72), F121 (≠ Q111), Q122 (≠ L112), E123 (≠ Q113), K171 (≠ A162), M266 (≠ I248), V293 (= V277), V400 (≠ I363), G426 (= G387), M428 (≠ I389), D453 (= D414), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), M485 (vs. gap), V486 (= V446), W489 (≠ I449), H558 (≠ E518)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (≠ P125), R161 (= R149), Y191 (≠ L176), R194 (≠ P179), D291 (≠ A275), R292 (≠ P276), D312 (= D292), W489 (≠ I449)
- binding flavin-adenine dinucleotide: R161 (= R149), G222 (= G207), G224 (≠ H209), T246 (= T229), L247 (= L230), M248 (≠ L231), L264 (≠ P246), G265 (≠ Y247), M266 (≠ I248), H267 (≠ E249), G286 (≠ L270), V287 (= V271), R288 (≠ D272), D290 (≠ K274), R292 (≠ P276), V293 (= V277), D310 (≠ V290), I311 (≠ P291), D329 (= D305), V330 (≠ I306), M405 (= M368), G423 (≠ L384), G424 (≠ T385)
- binding magnesium ion: D453 (= D414), N480 (= N441)
- binding thiamine diphosphate: V400 (≠ I363), G401 (≠ T364), Q402 (≠ S365), H403 (≠ S366), G426 (= G387), M428 (≠ I389), G452 (= G413), G454 (= G415), S455 (≠ T416), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), G484 (≠ S445), M485 (vs. gap), V486 (= V446)
Sites not aligning to the query:
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
25% identity, 95% coverage: 4:529/552 of query aligns to 14:564/582 of 1yi1A
- active site: Y33 (≠ N23), G35 (= G25), G36 (≠ T26), A37 (≠ S27), S38 (≠ E28), E59 (= E49), T82 (≠ H72), F121 (≠ Q111), Q122 (≠ L112), E123 (≠ Q113), K171 (≠ A162), M266 (≠ I248), V293 (= V277), V400 (≠ I363), G426 (= G387), M428 (≠ I389), D453 (= D414), N480 (= N441), H482 (≠ S443), L483 (≠ Y444), M485 (vs. gap), V486 (= V446), W489 (≠ I449), H558 (≠ E518)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (≠ A275), R292 (≠ P276), W489 (≠ I449)
- binding flavin-adenine dinucleotide: R161 (= R149), G223 (= G208), G224 (≠ H209), T246 (= T229), L247 (= L230), M248 (≠ L231), M263 (≠ L245), L264 (≠ P246), G265 (≠ Y247), M266 (≠ I248), H267 (≠ E249), G286 (≠ L270), V287 (= V271), R288 (≠ D272), D290 (≠ K274), V293 (= V277), D310 (≠ V290), I311 (≠ P291), D329 (= D305), V330 (≠ I306), M405 (= M368), G423 (≠ L384), G424 (≠ T385)
- binding magnesium ion: D453 (= D414), N480 (= N441), H482 (≠ S443)
Sites not aligning to the query:
Query Sequence
>GFF974 FitnessBrowser__Marino:GFF974
MTNGAQALMKTLVDAGVEVCFSNPGTSEMHFVAALDDEPKMRAVLALFEGVATGAADGYA
RMADKPAATLLHLGCGLGNGLANLHNARKGKVPVLNIVGDHATYHVKYDAQLQSDIETVA
RNVSPGFVRTAKSTETLCQDAAEAIAAARTAPGQVATLILPADVSWGEGGVPSAPLAPPT
PEPADDATVEAIAKAIRSGKKTALLMGGHSLREPSMLAAAKLAAHSGVTLLAETFPTRME
RGAGLPYIERIAYLAELATVQLTDIEQLILVDSKAPVSFFAYPGKKSYLVPDTCQVHTLA
APDQDILASLNKLNDAVGASQAQPKLQPEKRPGRPRGKLTAEKVCKAVGELMPENAIIVD
EGITSSLMLSVMTAGAPRHDMITLTGGAIGQGLPNAVGAAVACPDRPVIALIGDGTAMYT
IQALWTMAREQLNVTSIIFNNASYSVLNIELERVGAEEAGEKAKSQLDLRGPVINFAEMA
NGMGVHGVRVHTAEEMAKALEYAQRMPGPHVIEAMIPESLSGVKRRVLPWMLRALPSLPV
SVSRALKRKLAP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory