Comparing GFF981 FitnessBrowser__Phaeo:GFF981 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
P83788 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Pseudomonas fluorescens (see paper)
49% identity, 98% coverage: 8:397/397 of query aligns to 20:416/416 of P83788
1qz9A The three dimensional structure of kynureninase from pseudomonas fluorescens (see paper)
49% identity, 95% coverage: 8:385/397 of query aligns to 19:403/404 of 1qz9A
P70712 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Rattus norvegicus (Rat) (see paper)
29% identity, 94% coverage: 18:389/397 of query aligns to 69:462/464 of P70712
Sites not aligning to the query:
Q16719 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Homo sapiens (Human) (see 4 papers)
29% identity, 95% coverage: 15:392/397 of query aligns to 66:465/465 of Q16719
3e9kA Crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex (see paper)
29% identity, 92% coverage: 15:380/397 of query aligns to 61:444/446 of 3e9kA
2hzpA Crystal structure of homo sapiens kynureninase (see paper)
28% identity, 92% coverage: 15:380/397 of query aligns to 61:445/447 of 2hzpA
3lvmB Crystal structure of e.Coli iscs (see paper)
26% identity, 65% coverage: 18:274/397 of query aligns to 11:258/394 of 3lvmB
Sites not aligning to the query:
P0A6B7 Cysteine desulfurase IscS; NifS protein homolog; ThiI transpersulfidase; TusA transpersulfidase; EC 2.8.1.7 from Escherichia coli (strain K12) (see 4 papers)
26% identity, 65% coverage: 18:274/397 of query aligns to 5:252/404 of P0A6B7
Sites not aligning to the query:
P0A6B9 Cysteine desulfurase IscS; EC 2.8.1.7 from Escherichia coli O157:H7 (see paper)
26% identity, 65% coverage: 18:274/397 of query aligns to 5:252/404 of P0A6B9
Sites not aligning to the query:
P05341 Cysteine desulfurase NifS; Nitrogenase metalloclusters biosynthesis protein NifS; EC 2.8.1.7 from Azotobacter vinelandii (see 2 papers)
24% identity, 57% coverage: 18:242/397 of query aligns to 4:228/402 of P05341
Sites not aligning to the query:
8odqD Sufs-sufu complex from mycobacterium tuberculosis (see paper)
29% identity, 47% coverage: 142:328/397 of query aligns to 158:339/410 of 8odqD
Sites not aligning to the query:
7tlmA Structure of atopobium parvulum sufs (see paper)
27% identity, 47% coverage: 31:218/397 of query aligns to 34:236/415 of 7tlmA
5x6bJ Crystal structure of sepcyse-sepcyss in complex with trnacys from methanocaldococcus jannaschii (see paper)
29% identity, 29% coverage: 105:218/397 of query aligns to 100:224/377 of 5x6bJ
Sites not aligning to the query:
7tlpA Structure of atopobium parvulum sufs k235r (see paper)
23% identity, 60% coverage: 68:304/397 of query aligns to 67:300/391 of 7tlpA
Sites not aligning to the query:
7tlpB Structure of atopobium parvulum sufs k235r (see paper)
23% identity, 60% coverage: 68:304/397 of query aligns to 69:302/393 of 7tlpB
Sites not aligning to the query:
Q93WX6 Cysteine desulfurase 1, chloroplastic; NIFS-like protein 1; CpNifS1; Plastid sufS-like protein; Protein AtCpNifS; Selenocysteine lyase; EC 2.8.1.7; EC 4.4.1.16 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 39% coverage: 174:328/397 of query aligns to 239:390/463 of Q93WX6
Sites not aligning to the query:
>GFF981 FitnessBrowser__Phaeo:GFF981
MTDFSATKAMFSLPEGMIYLDGNSLGPMPRATAERVRGTIEDEWGEMLITGWNKAGWMQK
PTAIGDRIARLIGAEPGHVVMGDTLSIKVYQAVASALELNPTRKVVLSDNGNFPSDLYMV
EGLVKSLGPDYSLRVVAPEEVSANLTDDIAVLMLTEVDYRTGRKHDMKALTEQAHAAGVV
TVWDLAHSAGALPVDLAGCKADFAVGCTYKYLNSGPGGPAFIYVAPRHAEKARPALSGWL
GHAAPFDFDLNYKPGNGIERMRVGTPPVLQLAALEASMDIWDMADMADVRAKSIELCDLF
ITEVESRCPDLTLASPRDGTVRGSQVSFRFHEGYAAMQALIARGVVGDFRSPDIMRFGFT
PLYIDQGDVRAAVDIIEDVITNALWDSAEYKTRNAVT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory