Comparing GFF991 FitnessBrowser__WCS417:GFF991 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
46% identity, 99% coverage: 1:210/213 of query aligns to 3:213/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
46% identity, 99% coverage: 1:210/213 of query aligns to 1:211/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
46% identity, 99% coverage: 1:210/213 of query aligns to 1:211/212 of O86043
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
41% identity, 99% coverage: 3:212/213 of query aligns to 8:212/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
41% identity, 99% coverage: 3:212/213 of query aligns to 5:209/212 of 2cz2A
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
42% identity, 99% coverage: 3:212/213 of query aligns to 4:208/208 of 1fw1A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
42% identity, 99% coverage: 3:212/213 of query aligns to 8:212/216 of O43708
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
40% identity, 99% coverage: 1:211/213 of query aligns to 8:213/220 of 4kaeA
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
40% identity, 99% coverage: 1:211/213 of query aligns to 10:215/222 of 4kdyA
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
36% identity, 100% coverage: 1:212/213 of query aligns to 3:216/216 of 4pxoA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
36% identity, 99% coverage: 1:211/213 of query aligns to 6:226/231 of D2YW48
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
36% identity, 99% coverage: 1:211/213 of query aligns to 4:224/228 of 3n5oA
6m1tA Bacterial beta class sphingomonas chungbukensis glutathione s- transferase
30% identity, 85% coverage: 17:198/213 of query aligns to 16:190/201 of 6m1tA
Sites not aligning to the query:
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
25% identity, 98% coverage: 4:212/213 of query aligns to 4:213/219 of 3qawA
4gf0A Crystal structure of glutahtione transferase homolog from sulfitobacter, target efi-501084, with bound glutathione
28% identity, 70% coverage: 37:186/213 of query aligns to 36:186/208 of 4gf0A
Sites not aligning to the query:
1f2eA Structure of sphingomonad, glutathione s-transferase complexed with glutathione
29% identity, 85% coverage: 17:198/213 of query aligns to 16:190/201 of 1f2eA
Sites not aligning to the query:
4g9hA Crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione
25% identity, 93% coverage: 1:198/213 of query aligns to 3:192/202 of 4g9hA
2gdrA Crystal structure of a bacterial glutathione transferase (see paper)
27% identity, 93% coverage: 1:199/213 of query aligns to 1:195/202 of 2gdrA
2dsaA Ternary complex of bphk, a bacterial gst (see paper)
27% identity, 93% coverage: 1:199/213 of query aligns to 1:195/200 of 2dsaA
5f06A Crystal structure of glutathione transferase f7 from populus trichocarpa (see paper)
44% identity, 38% coverage: 1:80/213 of query aligns to 2:77/213 of 5f06A
>GFF991 FitnessBrowser__WCS417:GFF991
MELYTYYRSTSSYRVRIALALKGLDFTAVPVNLLVPAGGAHRQPEYLAINPQGRVPALRT
EEGELLIQSPAIIEYLDERYPQAPLLSRDLATRAHERAVASIIGCDIHPLHNSSTQNLLR
QWGHDEAQLLEWIGHWISQGLGAVEQLIGDQGFCFGEQPGLADTFLIPQLYAAERFKVPL
ASYPRIGRVAALAAQHPAFVRAHPANQPDTPAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory